2NV2,3FEM


Conserved Protein Domain Family
TIGR00343

?
TIGR00343: TIGR00343 
Click on image for an interactive view with Cn3D
pyridoxal 5'-phosphate synthase, synthase subunit Pdx1
This protein had been believed to be a singlet oxygen resistance protein. Subsequent work showed that it is a protein of pyridoxine (vitamin B6) biosynthesis, and that pyridoxine quenches the highly toxic singlet form of oxygen produced by light in the presence of certain chemicals. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine]
Statistics
?
PSSM-Id: 129443
View PSSM: TIGR00343
Aligned: 8 rows
Threshold Bit Score: 477.725
Threshold Setting Gi: 3123067
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NV2_A       9 VKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMALERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKARIGHIV 88
gi 3123067  15 IKRGFAKMQKGGVIMDVTNAEQAAIAEEAGAVAVMALHKVPADIRAAGGVARMADPKKIQEIIDAVTIPVMAKCRIGHIA 94
gi 3123062   8 LKKGFAKMTKGGVIMDVVNAEQAAIAEDSGAVAVMALEKVPADIRASGGVARMADPNKVQEIMDAVSIPVMAKVRIGHFV 87
gi 1176057   8 LNKNLAQMLKGGVIMDVQNPEQARIAEAAGAAAVMALERIPADIRAVGGVSRMSDPKMIKEIQGAVSIPVMAKVRIGHFV 87
gi 2501577   8 IKSGLAQMLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRMSDPKMIKDIMNSVSIPVMAKVRIGHFV 87
gi 1730655   6 VKTGLAQMLKGGVIMDVVTPEQAIIAERAGACAVMALERIPADMRKSGQVCRMSDPRMIKEIMEAVSIPVMAKVRIGHFV 85
gi 2501580   8 LKKGFAKMVKHGVVMDVTNVEQAQIAEEAGAVAVMALERVPADIRAAGGVARMSDPALIEEIMDAVSIPVMAKCRIGHTT 87
3FEM_A       8 IKSGLAQMLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRMSDPKMIKDIMNSVSIPVMAKVRIGHFV 87
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NV2_A      89 EARVLEAMGVDYIDESEVLTPADEEFHLNKNEYTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRHMRKVN 168
gi 3123067  95 EARALEALGVDMIDESEVLTPADVFFHIDKRKFVVPFVCGARSLGEAVRRIWEGAAMIRTKGEAGTGNVVEAVKHMRLIN 174
gi 3123062  88 EAQVLEALGVDMIDESEVLTPADERFHIDKKKFTVPFVCGARNLGEALRRIDEGAAMIRTKGEPGTGNIVEAVRHMRIMM 167
gi 1176057  88 EAQILEAIEIDYIDESEVLSPADNRFHVDKKEFQVPFVCGAKDLGEALRRIAEGASMIRTKGEPGTGDIVQAVRHMRMMS 167
gi 2501577  88 EAQIIEALEVDYIDESEVLTPADWTHHIEKDKFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRIT 167
gi 1730655  86 EAQILEELQVDYIDESEVLTPADWTHHIEKHNFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHITKIK 165
gi 2501580  88 EALVLEAIGVDMIDESEVLTQADPFFHIYKKKFNVPFVCGARNLGEAVRRIWEGAAMIRTKGEAGTGNIVEAVRHMRLMN 167
3FEM_A      88 EAQIIEALEVDYIDESEVLTPADWTHHIEKDKFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRIT 167
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NV2_A     169 AQVRKVVAMSE-DE------------------------LMTEAKn-------------LGAPYELLLQIKKDGKLPVVNF 210
gi 3123067 175 RAIFELQKMNE-ERiygvaekyasryaelasrvreemgLESVSRndvvfee-ytlgeiIDGIYEILLEIRELGRLPVVNF 252
gi 3123062 168 SEIREIQNK---EEe-----------------------ELWEVSr------------kIEAPLELVRETAKLGKLPVVNF 209
gi 1176057 168 QEIRRIQN-LR-EDe-----------------------LYVAAKd-------------LQVPVELVQYVHKHGKLPVVNF 209
gi 2501577 168 EEIKACQQ-LKsEDd-----------------------IAKVAEe-------------MRVPVSLLKDVLEKGKLPVVNF 210
gi 1730655 166 AEIQQYKENLKtESd-----------------------FAAKATe-------------LRVPVDLLKTTLSEGKLPVVNF 209
gi 2501580 168 EAIAQLQRMTD-EEvygvakfyanryaelaktvregmgLPATVLenepiyegftlaeiIDGLYEVLLEVKKLGRLPVVNF 246
3FEM_A     168 EEIKACQQLKS-EDd-----------------------IAKVAEe-------------MRVPVSLLKDVLEKGKLPVVNF 210
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NV2_A     211 AAGGVATPADAALMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHFTDYKLIAELSKELGTAMKGIEISNLLPEQ--- 287
gi 3123067 253 AAGGVATPADAALMMQLGADGVFVGSGIFKSSNPPEYAKAIVEAVQHYDEPEVVAEVSKGLGEAMKGLDVFKLSEDE--- 329
gi 3123062 210 AAGGVATPADAALMMQLGADGVFVGSGIFKSDNPEGYARAIVEATAHYDDPEVIAEVSRGLGTAMRGLEISEIPEEG--- 286
gi 1176057 210 AAGGIATPADAALMMQLGAEGVFVGSGIFKSGDPIKRASAIVKAVTNYRNPQILAQISEDLGEAMVGINENEIQILMaer 289
gi 2501577 211 AAGGVATPADAALLMQLGCDGVFVGSGIFKSSNPVRLATAVVEATTHFDNPSKLLEVSSDLGELMGGVSIESISHASng- 289
gi 1730655 210 AAGGVATPADAALLMQLGCEGVFVGSGIFKSSDPEKLACAIVEATTHYDNPAKLLQISSDLGDLMGGISIQSINEAGgkn 289
gi 2501580 247 AAGGVATPADAALMMQLGSDGVFVGSGIFKSENPLERARAIVEATYNYDKPDIVAEVSKNLGEAMKGIDITQISEAE--- 323
3FEM_A     211 AAGGVATPADAALLMQLGCDGVFVGSGIFKSSNPVRLATAVVEATTHFDNPSKLLEVSSDLGELMGGVSIESISHASng- 289

               ....*....
2NV2_A     288 --RMQERGW 294
gi 3123067 330 --RLQTRGL 336
gi 3123062 287 --RMQDRGW 293
gi 1176057 290 gk------- 291
gi 2501577 290 -vRLSEIGW 297
gi 1730655 290 gaRLSEIGW 298
gi 2501580 324 --KMQYRGD 330
3FEM_A     290 -vRLSEIGW 297
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap