Conserved Protein Domain Family
azlC

?
TIGR00346: azlC 
4-azaleucine resistance probable transporter AzlC
Overexpression of this gene results in resistance to a leucine analog, 4-azaleucine. The protein has 5 potential transmembrane motifs. It has been inferred, but not experimentally demonstrated, to be part of a branched-chain amino acid transport system. Commonly found in association with azlD. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129446
View PSSM: TIGR00346
Aligned: 3 rows
Threshold Bit Score: 296.349
Threshold Setting Gi: 3123102
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176150  16 AAKATFPYSVPMIAGFLFLGIAYGIYMKALGFGFLYPTLMALLIYAGSVEFIAAGALIAPFSPISVLLITLMISARQIFY 95
gi 3121821  28 AFRSAFPYTIPIFAGFLFLGIAYGIFMHSLGFSAIYPIIMSFMIFAGSMEFVAANFLLGAFNPMNALFLTLMVNARHLFY 107
gi 3123102   7 AFKDAFPHTISILLGYLLMGMTFGMLLVQQGYDYKVALFMSLFIYAGAVQFVAITLLSAQASLMNVVIVSLLVNARQTCY 86
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176150  96 GISMLEKYgIHIGKKRWYLITTLVDESFSLNYMAKIPPHLDKGWYMFFVSLYLHIYWVLGAAMGNLFGTVLPFNLKGVEF 175
gi 3121821 108 GISMLDKY-RGTGKKKLYLIFGMCDESFSINYTANVPANVDKGWFMFFVTLLNHLYWVAGAAIGGIFGSYVKFNTEGLDF 186
gi 3123102  87 ALSMLDRF-KNTKWRLPYLAHALTDETFALLNLYAPKEGVSEKDFIFSISLLNHSYWIFGSLVGSLVGSHFSFDTQGMEF 165
                      170       180       190       200       210       220
               ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1176150 176 SMTALFLVIFAENWLKGKSHESSLLGLGIALVFLLIIGKEYFLIPTLIGIWLILTMRITKLE 237
gi 3121821 187 VMTALFIVIFIEQWMKEKKHYSALTGLGLSVASLILFGGNQFIIPAMLAILGVLTVLRKPLE 248
gi 3123102 166 VMTAIFIVLFMEQYKRTTNHKNAWLGIVIAVVCLALFGTEYFLLIALVLMVLALMLFRKQLE 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap