3E0O


Conserved Protein Domain Family
TIGR00357

?
TIGR00357: TIGR00357 
Click on image for an interactive view with Cn3D
methionine-R-sulfoxide reductase
This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested. [Protein fate, Protein modification and repair, Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 129454
View PSSM: TIGR00357
Aligned: 9 rows
Threshold Bit Score: 231.966
Threshold Setting Gi: 16329386
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3E0O_A         3 AYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPI-EEEVEEKLD 81
gi 1351814   210 KPSDAELKAKLTPLQYSVTQNKHTERSFSNEYWDNFQPGIYVDITTGEPVFSSNDKFESGCGWPSFTKPIiKDVVHYETD 289
gi 2499564     6 KKSDGELKRTLTKLQYDVTQNAHTEPPYTNEYNRHYEKGIYVDITSGEPLFISTDKFKSGCGWPAFTKPIsQDLIANYRD 85
gi 1351585     6 KKSEAELKRTLTKLQFDVTQNAHTEPPYINEYNRNFEKGIYVDITSGEPLFISTDKFKSGCGWPAFSKPIdKNLIANYRD 85
gi 1730949     2 AYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPI-EEEVEEKLD 80
gi 2507186     4 KPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVsEESIRYIKD 83
gi 20455078   22 ELSDDEWREILDPEAFRVARKAGTEPPFTGKYHDLHDDGIYRCICCGTDLFDSETKFDSGTGWPSFYDVVsEHNIKLRED 101
gi 499173837  52 TKTDAEWQQQLSPEAYKVLRKHGTERAGTSPLDKNYDLGTYECAGCELPLFSSETKFNSGTGWPSFYAPL-ENAVAYTVD 130
gi 3914383   203 KPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFSSADKYDSGCGWPSFSKPInKDVVKYEDD 282
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
3E0O_A        82 TSHGMIRTEVRSRTADSHLGHVFNDGP-GPNGLRYCINSAALRFVPKHKLKEEGY 135
gi 1351814   290 NSFNMQRTEVLSRAGNAHLGHVFDDGPkDKGGLRYCINSASIKFIPLAEMEKAGY 344
gi 2499564    86 ESHGMIRTEVRAKNSNSHLGHVFRDGPeEHGGLRYCINSAALKFIPFAEMESAGY 140
gi 1351585    86 ESHGMIRTEVRAKNSDSHLGHVFNDGPsELGGLRYCINSAALKFIPFEEMEKLGY 140
gi 1730949    81 TSHGMIRTEVRSRTADSHLGHVFNDGP-GPNGLRYCINSAALRFVPKHKLKEEGY 134
gi 2507186    84 LSHGMQRIEIRCGNCDAHLGHVFPDGP-QPTGERYCVNSASLRFTDGENGEEING 137
gi 20455078  102 RSLGMVRCEVLCARCDAHLGHVFDDGP-RPTGKRYCMNSAALKFIPRD---QIG- 151
gi 499173837 131 KSFFMTRTEVHCARCGGHLGHVFDDGP-QPTGKRYCMNGVSLKFVGA-------- 176
gi 3914383   283 ESLNRKRIEVLSRIGKAHLGHVFNDGPkELGGLRYCINSAALRFIPLKDMEKEGY 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap