Conserved Protein Domain Family
TIGR00363

?
TIGR00363: TIGR00363 
lipoprotein, YaeC family
This family of putative lipoproteins contains a consensus site for lipoprotein signal sequence cleavage. Included in this family is the E. coli hypothetical protein yaeC. About half of the proteins between the noise and trusted cutoffs contain the consensus lipoprotein signature and may belong to this family. [Cell envelope, Other]
Statistics
?
PSSM-Id: 129460
View PSSM: TIGR00363
Aligned: 3 rows
Threshold Bit Score: 437.025
Threshold Setting Gi: 1171732
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 401469   14 LIGSLALVGCGQDEKD-----PNHIKVGVIVGAEQQVAEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQH 88
gi 1171732  12 IASALVLTGCKEDKKPeaaaaPLKIKVGVMSGPEHQVAEIAAKVAKEKYGLDVQFVEFNDYALPNEAVSKGDLDANAMQH 91
gi 128372   15 LLAGILLAGCDQSSSD-----AKHIKVGVINGAEQDVAEVAKKVAKEKYGLDVELVGFSGSLLPNDATNHGELDANVFQH 89
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 401469   89 KPYLDQQLKDR-GYKLVAVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGLLPTV 167
gi 1171732  92 KPYLDEDAKAKnLNNLVIVGNTFVYPLAGYSKKIKNVNELQDGAKVVVPNDPTNRGRALILLEKQGLIKLKDANNLLSTV 171
gi 128372   90 RPFLEQDNQAH-GYKLVAVGNTFVFPMAGYSKKIKTVAQIKEGATVAIPNDPTNLGRALLLLQKEKLITLKEGKGLLPTA 168
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 401469  168 LDVVENPKNLKIVELEAPQLPRSLDDaqIALAVINTTYASQIGLTPAKDGIFVEDKESPYVNLIVTREDNKDAENVKKFV 247
gi 1171732 172 LDIVENPKKLNITEVDTSVAARALDD--VDLAVVNNTYAGQVGLNAQDDGVFVEDKDSPYVNIIVSRTDNKDSKAVQDFI 249
gi 128372  169 LDITDNPRHLQIMELEGAQLPRVLDDpkVDVAIISTTYIQQTGLSPVHDSVFIEDKNSPYVNILVAREDNKNAENVKEFL 248
                      250       260
               ....*....|....*....|....
gi 401469  248 QAYQSDEVYEAANKVFNGGAVKGW 271
gi 1171732 250 KSYQTEEVYQEAQKHFKDGVVKGW 273
gi 128372  249 QSYQSPEVAKAAETIFNGGAVPGW 272
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap