Conserved Protein Domain Family
TIGR00370

?
TIGR00370: TIGR00370 
sensor histidine kinase inhibitor, KipI family
[Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129467
View PSSM: TIGR00370
Aligned: 3 rows
Threshold Bit Score: 347.225
Threshold Setting Gi: 2495572
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175716  10 LGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQpfPGFIECIPAFTSLTVFY-DMYEVYKHLPQGISSPFESVKrdveerl 88
gi 1176147   6 ISESAVVCSLPPPASIQQQRQLWAFARQLQSE--QDIVEVVLGMNNLTVFT-DFFVDFKPLVQRLEQLWAELK------- 75
gi 2495572   9 IGETAVVLELEPPVTLASQKRIWRLAQRLVDM--PNVVEAIPGMNNITVILrNPESLALDAIERLQRWWEESE------- 79
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175716  89 aeiaeDYEVNRRIVEIPVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAPRKSSP 168
gi 1176147  76 -----VSDFQGRHIEIPVIYGGERGQDLSDVAKFHQTTPERIIQMHSEPIYTVYMIGFQAGFPYLGGLPENLHTPRRATP 150
gi 2495572  80 -----ALEPESRFIEIPVVYGGAGGPDLAVVAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEP 154
                      170       180       190       200       210
               ....*....|....*....|....*....|....*....|....*....|....*..
gi 1175716 169 RPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIVKFV 225
gi 1176147 151 RTVVPAGSVGIGGAQTGIYPFSSPGGWQLIGYTKQALFDKNQAQPTLLQAGDTVKFI 207
gi 2495572 155 RLLVPAGSVGIGGPQTGVYPLATPGGWQLIGHTSLSLFDPARDEPILLRPGDSVRFV 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap