Conserved Protein Domain Family
TIGR00373

?
TIGR00373: TIGR00373 
transcription factor E
This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain. [Transcription, Transcription factors]
Statistics
?
PSSM-Id: 129469
View PSSM: TIGR00373
Aligned: 3 rows
Threshold Bit Score: 233.983
Threshold Setting Gi: 11498363
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182702114   4 DPLVQEVLFNIFEgdEKGFEVIDVLLeKGETTEEEIAKELGVKLNVVRKLLYKLYDARLVDYKRWKDEDTNWYSYTWLPT 83
gi 499179736   8 QELIHEVITEEEE--EEAIPVLECLM-KGKVTDEEISEKTQLKLNIVRRILYRLYDAGVASYKRSKDPETQWYTYTWKFE 84
gi 499180720  10 EELLNELVGRAAG---EVGLILFSLGiEGEFTDDQLSLELGIEINEIRKALFALYEIGLADYVRRRDDETGWMEYYWRIN 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182702114  84 LEKLPYVVKKKINELIKDLEKKLEFEKNNMFFFCPNCNVRFTFEEAMDYGFSCPGCGNMLQEFDNSELIKDLEEQIKFLK 163
gi 499179736  85 PEKVTEMIKRKHSEIVRKLREALEFEENNMFFVCVNGHYRFTFDEATEENFTCPECGSKMEFMDNSEIIQEIKDELSLYE 164
gi 499180720  87 YDKALDVLKRELEKTAKKLREKIEAETSTIYYICPNMCVKVSYNDAMELNFTCPRCGAMLDYLDCSKAIEKieeevrrie 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap