Conserved Protein Domain Family
TIGR00374

?
TIGR00374: TIGR00374 
conserved hypothetical protein
This model is built on a superfamily of proteins in the Archaea and in Aquifex aeolicus. The authenticity of homology can be seen in the presence of motifs in the alignment that include residues relatively rare among these sequences, even though the alignment includes long regions of low-complexity hydrophobic sequences. One apparent fusion protein contains a Glycos_transf_2 region in the N-terminal half of the protein and a region homologous to this superfamily in the C-terminal region. [Unknown function, General]
Statistics
?
PSSM-Id: 129470
View PSSM: TIGR00374
Aligned: 7 rows
Threshold Bit Score: 175.648
Threshold Setting Gi: 7388464
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7388440    20 IVLSFLAVAVVIFLIGFfagfGDILRALEGTSPYFLALNFVLEAIILILWTLRWRLILNVVDDAPSFPRLMMLLFTSIFG 99
gi 7388469     9 IVIGVVALAAMILIIGP----GEIEDALRKADPVYVLMAVVLEFIILALFTLRWSITTRAVSIDVGKRHLFPMLLVGMAI 84
gi 7388524    13 LIISFLFILAIMAYIGL----DKIIKVLINTNPEYVILAFILQILVSVILSARWKFIIKILGYSANFKNIFLLVLMGLFI 88
gi 7388464     1 -----------------------------------------------------------------------------MFI 3
gi 7388383    10 FALSILLILALIIWMGP----SRIIRAVYMADWMIIAIALLIHMGVLAVRGLRWGFII--G-QPWRMRVNFMVKTIGLFA 82
gi 7388529     4 ILVSIAVTAIIFKYTES----ELTWSVIKRANWLLLIVAFLLQVSFWLLWALRMKLLSNYLGYRISFFHSLEITMASMFT 79
gi 499182958  13 SVLLVFFLLLSFLFLAYrsfsPEALYLVGNLNKFYLLLAFFCLFLVHTFDNARLFIISRALGIKYSFLYGYITSFVNTFG 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7388440   100 NNITPGAAGG-EPLRAYLLREVEGTPFEIGFASSTADRVFEFIPFALISILSAVl-iMTWEISIWTRIVVSVLILVTIAG 177
gi 7388469    85 NNLTPSARGGgEPVRAYMLGKYSRASMESAFATVIADRGLDTFPFIFLAVLTIIgivLYFDLSRWILAALIASVVIIVVA 164
gi 7388524    89 NNITPSMRGGgEAFRAYYLSKLEEIPKGLAFSTVVVERVLDTAIFLFFTLFVIG----YFVVTGFKYLEYLILSWIFLFS 164
gi 7388464     4 NSLVPAKLGD--VYRGYLLKKKTNESISLGVGTVFIERVFDLVAMISLLFISAY---LSFKSDIPKEILYSIKWGVIIIL 78
gi 7388383    83 GNLSPMRSAG-EVMNALAGKKLNGIELSEGLSAGLTERFFDLGIGGGLLLLAAV---MVPVIRVIALFGAILSVLITYLI 158
gi 7388529    80 ASITPSSAGG-EPVRVKMLSDR-GVEVGTSAFIVLAERILDSMYFSTALPVFLI----VTGFSTSFGFKIAIIFITLLLV 153
gi 499182958  93 ATVTPAHIGG-EGMAVYMLLRK-GISAHKVATAVTFKTVTGMVFFILCFPFLIL-----QTLKSPKNFINLFLILLVLLL 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7388440   178 FS-LAVYAGMNKKIAQRIALSVTRrLVSWFSRFREggisfagIHEKVIFYINRFNDGFSTAITDR-RVFVIGFFISLGMW 255
gi 7388469   165 FF-LALYVSVDRDAGERITGWILG-VVKRFYRKNHe-----rLERRVRSALHEFQSTMRMMLKEK-NVLVYGIPISFLIW 236
gi 7388524   165 LTaIIIYLIANKGLLIKTVTKISKfICKYCSYNYD--------ETKILQSIEEFYNSMKFFKNKRgWEVVVAIFLSVMRY 236
gi 7388464    79 FL--IILIFGFLIVNSKINLKNKK----------------------LEAILMNFEKGLKAVKLNT---LPLLITLSFTGW 131
gi 7388383   159 YL-VNWREEKGLRIYQRIHSIIERlPVSEETLEN--------LYERLTSGIKGMIGYTRSYSNFT--SLGVIFILSLLSW 227
gi 7388529   154 FLyILYRIFRNESSIDKFAQLLYKaVRKFNEKKAEk------YSSTFSRELRRFREATIKMLSDSpSGILVLYLVTLVMW 227
gi 499182958 166 FT--PLFFTGIKKFLKKKDSEGLG--------------------SKLRKFLVKYLGAVKFFYKRKkAEFLLASLSSIGLY 223
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7388440   256 ALDVCRLYVCFLAVGVSPPAVPLIIIYTVGILISLLPILPGSLGLREGILVGLFAVAGIGADYVMAASVVDRIASYIAPT 335
gi 7388469   237 ILEIIRVYLIFTAFGTDISLLVIAEVFILATLIGMIPLLPGGLGAVDGIMIVFYSYAGVSPSVSAAATVVERLISFWMIS 316
gi 7388524   237 IFDILKLWLLFLSLSYVVSVICVSAVYLITLLSGVLSITPSGFGTADTVMILSFSAFNIPPSVAAAVTLLDRLVSYILPT 316
gi 7388464   132 FIEGLTVYFIFLSLNLNLEILFGVFSDLASSLLTAIPLTPSGLGVVEYALIYILKLKNIDYSGAFAVLILYRLISYFSIV 211
gi 7388383   228 LMECLRLYLVFMAFGVETSFSAVIIIFLLANLVGILSALPGGMGSMEVSMAGLFVVFGVPGFLAGSIALVDRIISFWMVT 307
gi 7388529   228 SASFAIPSVILVALGYDAYFLYSYTAQLIIVIVSLVPLTPGSSGIAEVSMAYLYSNF-VPTNVLGVLVGLWRLITYHTNI 306
gi 499182958 224 LSFLFIAFFLLLSFGKEVSPLEILSLQLGLLYAIFVSPTPGGSGVGEIGGYVIFAGL-LGQNEVGVFVLLWRLISQYFSA 302
                        330
                 ....*....|....*.
gi 7388440   336 LIGLIAAIYYGKQMTS 351
gi 7388469   317 AMGVAAIPYFGSSVSE 332
gi 7388524   317 ILGYIAMLIIKREIDK 332
gi 7388464   212 LFGAIMFYIVERNILK 227
gi 7388383   308 ALGAIFSSCYAGEIFD 323
gi 7388529   307 FFGAISVNYSLIKSKF 322
gi 499182958 303 FLGGILFFICLLIDTK 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap