3K8N


Conserved Protein Domain Family
dsbE

?
TIGR00385: dsbE 
Click on image for an interactive view with Cn3D
periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily
Involved in the biogenesis of c-type cytochromes as well as in disulfide bond formation in some periplasmic proteins. [Protein fate, Protein folding and stabilization]
Statistics
?
PSSM-Id: 129481
View PSSM: TIGR00385
Aligned: 6 rows
Threshold Bit Score: 267.028
Threshold Setting Gi: 134044263
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K8N_A         6 L-LIPLIIFLAIAAALLWQLARNAEGDDPTNLESALIGKPVPKFRLESLDNPgQFYQaDVLTQGKPVLLNVWATWCPTCR 84
gi 1169432     5 L-LVPLILFLSITIAFLVQLKRNAQGEDIKALESALVGKPVPAKNLTELFEN-KTYTnELFQQGEPVLLNVWATWCPTCY 82
gi 465621      6 L-LIPLIIFLAIAAALLWQLARNAEGDDPTNLESALIGKPVPKFRLESLDNPgQFYQaDVLTQGKPVLLNVWATWCPTCR 84
gi 1169433     5 L-IFFTPLFVLLGVCILLIAGLNQ---DPKKIASALIDKPVPEFYQANLHEPsQIVSpKEFPK-QPFLLNVWGSWCGYCK 79
gi 134044263   7 MmLLPVAIFAGFAGLSGWALLRDD----PDALPSAMIGREAPSVGEATLPGKvQLTD-EMLRQPGVKLVNFWASWCPPCR 81
gi 1169166     6 LaLLPLIVFGGIAHGAKMLYDQDFHGKNIAEIPSALSHQGADAEPAAARRATlPALT-DAAIKGKLTLVNVFASWCLPCR 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K8N_A        85 AEHQYLNQLSAQG-IRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDL 163
gi 1169432    83 AEHQYLNKLAKEG-VRIIGLDYKDESPKAMKWLKDLGNPYQVVLKDEKGSFGLDLGVYGAPETFIVDGKGVIHYRYAGDV 161
gi 465621     85 AEHQYLNQLSAQG-IRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDL 163
gi 1169433    80 EEHPLLIEIAKT--LPIVGVDYRDNRQNGIKMLKRMGNPFILTIDDSHGELGLKLGVDGAPETYLVDENGVIRYRHSGLL 157
gi 134044263  82 AEHPTLTELSAR--LPVYGVDLKDPEGAALGFLSEHGDPFHALAADPRGRVAIDWGVTAPPETFIIDGSGRILHRHAGPL 159
gi 1169166    85 DEHPVLKELAKDGrLNIVAINYKDQSDNALRFLGELGNPYQAIGIDPNGKAAIDWGVYGIPESYLVGADGTILYKRVGPS 164
                        170
                 ....*....|....*
3K8N_A       164 NPRVWEEEIKPLWEK 178
gi 1169432   162 NEKVWTQTLKPIYDK 176
gi 465621    164 NPRVWEEEIKPLWEK 178
gi 1169433   158 DKETWQTVFLPKIEA 172
gi 134044263 160 VREDYTNRFLPELEK 174
gi 1169166   165 TNISLKEGLVPAMEK 179
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap