Conserved Protein Domain Family
mauM_napG

?
TIGR00397: mauM_napG 
MauM/NapG family ferredoxin-type protein
MauM is involved in methylamine utilization. NapG is associated with nitrate reductase activity. The two proteins are highly similar. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129492
View PSSM: TIGR00397
Aligned: 3 rows
Threshold Bit Score: 353.066
Threshold Setting Gi: 2494441
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494441  10 KVTRRDAMADAARAVGVACLGGFSLAALVRTASPVDARAIRPPGALPEQDFLAACVHCGLCVQACPYGTLSLAEWSDEAE 89
gi 2494440  13 EPERRKVFRKVFRQLGAATVITMFGKAVLDSRPARAASVLRPPGALPEPEFNAACIRCGLCVEACPLDILHLASWSDPAP 92
gi 2494439  17 KPERRLMFKQLTRRVGVAVVGSIFGSALLRSRPAPAATVLRPPGALAEKDFQSACVRCGLCVEDCPFDILKLASWADPAP 96
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494441  90 LGTPFFTPREVPCYMCKDVPCARACPTGALDRDIPSIRDADMGVAVLVGHETCLNYKGLNCSICVRVCPIRGDAISLEPQ 169
gi 2494440  93 TGTPYFVGRTDPCRMCPDIPCARACPTGALSPLLTDIKKADMGVAVLVGHETCLNYKGLTCSICVRVCPIIGEAISLKQI 172
gi 2494439  97 MGTPFFTARDEPCRMCQDIPCVRACPTGALNPLLTDIRKADMGVAVLVDHETCLNYKGLNCSICVRVCPIRGEAISLKPI 176
                      170       180       190       200       210
               ....*....|....*....|....*....|....*....|....*....|...
gi 2494441 170 EIDGRRVMIPVVHSASCTGCGTCEKQCVLGHAAIRVLPRDLGLGGPGRNRAGR 222
gi 2494440 173 KNERGVLQIPTVDSSKCTGCGTCEKHCVLSEAAIRLLPRELGLGVEGAQSVGR 225
gi 2494439 177 QNERGLLQIPTVDSTKCTGCGTCEKHCVLSEAAIRVLPRELGLGVSGANSAGR 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap