Conserved Protein Domain Family
ndhI

?
TIGR00403: ndhI 
NADH-plastoquinone oxidoreductase subunit I protein
[Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129498
View PSSM: TIGR00403
Aligned: 3 rows
Threshold Bit Score: 352.294
Threshold Setting Gi: 120536
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 128917     1 MFNnILKQVGDYAKESLQAAKYIGQGLAVTFDHMSRRPITVQYPYEKLIPSERFRGRIHFEFDKCIACEVCVRVCPINLP 80
gi 120536     1 MFS-IINGLKNYNQQAIQAARYIGQGFLVTLDHMNRLPTTIQYPYEKLIPSERFRGRIHFEFDKCIACEVCVRVCPINLP 79
gi 11466851   1 MFP-MVTGFMG--QQTIRAARYIGQSFIITLSHTNRLPITIHYPYEKSITSERFRGRIHFEFDKCIACEVCVRVCPIDLP 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 128917    81 VVDWEFNKAVKKKELKHYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELAAYDRHDLNYDNVALGRLPYKVTEDPMVTPLR 160
gi 120536    80 VVDWELKKTIKKKQLKNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELSTYNRHELNYDQIALGRLPISIIEDSTIENIF 159
gi 11466851  78 LVDWRFEKDIKRKQLLNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELSTYDRHELNYNQIALSRLPISIMGDYTIQTIR 157
                       170       180
                ....*....|....*....|....*..
gi 128917   161 ELGYLPKGVIEPHnlpKGSQRAGQHPE 187
gi 120536   160 NLTSLPKGKIEGH---IYSRNITNIVN 183
gi 11466851 158 NSTQS-KIDEEKS---WNSRTITDY-- 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap