Conserved Protein Domain Family
KOW_elon_Spt5

?
TIGR00405: KOW_elon_Spt5 
transcription elongation factor Spt5
This protein contains a KOW domain, shared by bacterial NusG and the uL24 (previously L24p/L26e) family of ribosomal proteins. The most recent papers and crystal structures make this a transcription elongation factor rather than a ribosomal protein.
Statistics
?
PSSM-Id: 129499
View PSSM: TIGR00405
Aligned: 3 rows
Threshold Bit Score: 213.214
Threshold Setting Gi: 15679672
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499343     3 FAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVP------GTIAIEEI 76
gi 499180504   5 FAVKTTANQERVVANLMDMAARKHNLKVYSILAPKELKGYIIVEAETPDDLLKAIRGLPHVKGVVK------GEISFSEI 78
gi 499179745  19 YALKTSVGQEKNVARMLARKVRDSGIEINAILVPESLRGYILVESSSKIDMRNPAIRVPHLRGVVEsktegeAEIDFEEV 98
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2499343    77 EPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD 147
gi 499180504  79 EHFLTPKKAAEQIREGDKVEIVSGPFKGEMAIVKRVDEAKNEITVELLEAVVPIPVTVKADHVRVIDKKEE 149
gi 499179745  99 KRFLKPEPIISSIKKGSIVELISGPFKGERAKVIRIDESREEVVLELIEAAVPIPVTVKGDQIRIIQKEAD 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap