1NHO,1FO5


Conserved Protein Domain Family
redox_disulf_1

?
TIGR00411: redox_disulf_1 
Click on image for an interactive view with Cn3D
small redox-active disulfide protein 1
This protein is homologous to a family of proteins that includes thioredoxins, glutaredoxins, protein-disulfide isomerases, and others, some of which have several such domains. The sequence of this protein at the redox-active disufide site, CPYC, matches glutaredoxins rather than thioredoxins, although its overall sequence seems closer to thioredoxins. It is suggested to be a ribonucleotide-reducing system component distinct from thioredoxin or glutaredoxin. [Unknown function, General]
Statistics
?
PSSM-Id: 129505
View PSSM: TIGR00411
Aligned: 4 rows
Threshold Bit Score: 124.224
Threshold Setting Gi: 2501199
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NHO_A      3 VNIEVFTSPTCPYCPMAIEVVDEAKKEFGDKIDVEKIDIMVDREKAIEYGLMAVPAIAINGVVRFVGAPSREELFEAIND 82
gi 3334206  2 VMMKLFTSPTCPYCPKAEKVVSKVAKEEGVLAINLPVNTDEGLKEALKFGIRGVPALVINDKYLILGVPDEGELRQLIRK 81
gi 2501199  4 VKIELFTSPMCPHCPAAKRVVEEVANEMPDAVEVEYINVMENPQKAMEYGIMAVPTIVINGDVEFIGAPTKEALVEAIKK 83
1FO5_A      4 VKIELFTSPMCPHCPAAKRVVEEVANEMPDAVEVEYINVMENPQKAMEYGIMAVPTIVINGDVEFIGAPTKEALVEAIKK 83

              ..
1NHO_A     83 EM 84
gi 3334206 82 LK 83
gi 2501199 84 RL 85
1FO5_A     84 RL 85
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap