1ILO


Conserved Protein Domain Family
redox_disulf_2

?
TIGR00412: redox_disulf_2 
Click on image for an interactive view with Cn3D
small redox-active disulfide protein 2
This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin. [Unknown function, General]
Statistics
?
PSSM-Id: 129506
View PSSM: TIGR00412
Aligned: 3 rows
Threshold Bit Score: 101.52
Threshold Setting Gi: 11499829
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
1ILO_A        2 MKIQIYGTGCANCQMLEKNAREAVKELGIDAEFEKIKEMDQILEAgLTALPGLAVDGELKIMGRVASKEEIKKILS 77
gi 2494806    6 VVIRIFGTGCPKCNQTYENVKKAVEELGIDAEIVKVTDVNEIAEW-VFVTPGVAFDDVIVFEGKIPSVEEIKEELK 80
gi 499182197  1 MKIKVVGPGCARCKATFDVVKKVVEKEGLDVELEYVTDMNEAIELgVVATPAVWVDGKVVIQGKIPKESEILEIIK 76
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap