Conserved Protein Domain Family
serS_MJ

?
TIGR00415: serS_MJ 
seryl-tRNA synthetase, Methanococcus jannaschii family
The seryl-tRNA synthetases from a few of the Archaea, represented by this model, are very different from the set of mutually more closely related seryl-tRNA synthetases from Eubacteria, Eukaryotes, and other Archaea. Although distantly homologous, the present set differs enough not to be recognized by the pfam model tRNA-synt_2b that recognizes the remainder of seryl-tRNA synthetases among oither class II amino-acyl tRNA synthetases. [Protein synthesis, tRNA aminoacylation]
Statistics
?
PSSM-Id: 129509
View PSSM: TIGR00415
Aligned: 2 rows
Threshold Bit Score: 962.873
Threshold Setting Gi: 3122916
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3122916   3 LTFDLDGKIIFSKELSEEAKNAVEEVLKNADSIFLKGVPKGKENEASKIKSYEFEGNILKLKIASGTYTRAHEGLIRLRK 82
gi 3122907   1 MKFKLKGIIKLSKEVPGIEDDLEKFFTEAESDILRRGVPEGQEHEAAHIKSWRLEGDTLHIEMESGRRVRAHDGLLRLKK 80
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3122916  83 PLAEKLGRNFRIGVRGIEIDNYVITIETD-EDKAKKLEGIKVPECEAKVEGnKIILTFKDIGESELKRNIIDRAIKFVKT 161
gi 3122907  81 PLGQLLGPKYRVGVRGISVTDYTMEMKAPgVSGIPSLAELPFVEDAAITDG-TIMVRFQPLEESDLRKHVFDRVVKHART 159
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3122916 162 ELEKEEeDLTFKVCKIPPGTIVSEYKAkRKITFDKDPTDVAEKLGWVKKFPGRGQWFYTPPITALFRALEELIVEEVVKK 241
gi 3122907 160 LVESSD-DLTVQVTRATPGEIIARSRS-RDFFFEGDPTEEAMRLGWVKKFPGRGQWFYGPKITALHRALEEFFIERIVKP 237
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3122916 242 IGFQECLFPKLIPLEIMYKMRYLEGLPEGMYYVCPPKREPELFKEFVNEMMIKKEIPIEKLKNLLRDPGYVLAPAQCEPF 321
gi 3122907 238 LGFVECLFPKLIPLDIMNKMRYLEGLPEGMYYCSAPSRDPETFEEFKNELIINREVPMDLLKRGIKDPGYVIAPAQCEPF 317
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3122916 322 YQFFEGEVID-VDKPIMFFDRSGWTYRWEGGGARGLDRVNEFLRVECVWIGSPEFVEETRDKTLKYAEKLAEKLDLEYWV 400
gi 3122907 318 YQFLSHEVVSaEDLPVKFFDRSGWTYRWEAGGSKGLDRVHEFQRVELVWLAEPGETEEIRDRTVELSHDAADELELEWYT 397
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3122916 401 EVGDDPFYLEGRKKEDRGIEFPDVPKYEMRLWLPHIKderKGVAVTSANVHGTHFVEGFRIKDYKGRRVWTGCTGYGITR 480
gi 3122907 398 EVGDDPFYLEGRKVEERGIEFPDVPKYEMRLSLPGRE---KGVAVVSANVHGTHFIEGFSIREARNLNIWTGCTGIGLSR 474
                      490       500       510       520
               ....*....|....*....|....*....|....*....|
gi 3122916 481 WVVGYLAQYGFNFDDWHPIIKKKIKKLpEVPQLITWPKKD 520
gi 3122907 475 WIYGFLAQKGFETGNWPDFIGERVEGV-ENPRIITWPRQD 513
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap