Conserved Protein Domain Family
TIGR00427

?
TIGR00427: TIGR00427 
membrane protein, MarC family
MarC is a protein that spans the plasma membrane multiple times and once was thought to be a multiple antibiotic resistance protein. The function for this family is unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 129521
View PSSM: TIGR00427
Aligned: 5 rows
Threshold Bit Score: 219.197
Threshold Setting Gi: 3025198
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506648   2 IQTffdFPVYFKFFIGLFALVNPVGIIPVFISMTSYQTAAARNKTNLTANLSVAIILWISLFLGDTILQLFGISIDSFRI 81
gi 3915499   1 MDIagyLSFFFASFTTLFIIIDPPGNLPIFIALTERFSDEYREKISKRATIIAFLILFITMVTGGKILDYFGVSISSLKI 80
gi 3025198   1 MD----LQYFILAFSSIFSILNPFGAVPVFITLTESYPKKERDLVAKKTVIYALAILLAFALFGEWILKFFGISLDAFKI 76
gi 3024952  17 MDI---LNFYIYGFVSLFITIDPIGLIPIVHSLTYPYPKEQRIRIIKKAIISSTVVLLLFALFGNYIFGYFGITIDAFRV 93
gi 3915579   1 MM----FSFIVHVFISLFAVSNPIGNVPIFLTLTEGYTAAERKAIARKAAILSFFILAAFLVFGHLIFKLFDINIHALRV 76
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506648  82 AGGILVVTIAMSMISGkLGEDKQNK-QEKSETAVRESIGVVPLALPLMAGPGAISSTIVWGTRYHSISYLFGFFVAIALF 160
gi 3915499  81 AGGILLFISSVDILLG-GTRREAYK-RRAEESIDVDSIAVFPLALPLYTGPGAITAGIVLYSQAGDVVMKLLVVLSAALV 158
gi 3025198  77 AGGILLLLISLDMVRG-QQEAKIHR-KEIEAAYEIDEIALMPLATPLLAGPGSITACMVAMAEASDIGDKFLVILAILLS 154
gi 3024952  94 AGGILLFKIAWDMLHA-EIPKTKHKpDERLDLEDIDSIVYVPLAIPLISGPGAITTTMILISKTQSILEKGVVVLSILSA 172
gi 3915579  77 AGGIFIFGIAYNLLNAkESHVQSLHhDEHKESKEKADISVTPLSIPIIAGPGTIATVMSLSAGHSGIGHYAAVMIGIAAV 156
                      170       180       190       200
               ....*....|....*....|....*....|....*....|....*.
gi 2506648 161 ALCCWGLFRMAPWLVRVLRQTGINVITRIMGLLLMALGIEFIVTGI 206
gi 3915499 159 YSIVRLSHIYSAPIIRLLGRSGADIAARILAIFLAAIAVEFVFDGL 204
gi 3025198 155 LGITYLTLLSAESVLDRIGRLGIRILTRMMGLILTAIAVQMIVNGI 200
gi 3024952 173 MLVSGIILSLTDFIIRRVNIYGINAFVRIMGLLLVAISVQIIFTGI 218
gi 3915579 157 IALTFLFFHYSAFISSKLGKTEMNVITRLMGLILAVVAVGMIGAGL 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap