Conserved Protein Domain Family
Q_tRNA_tgt

?
TIGR00430: Q_tRNA_tgt 
tRNA-guanine transglycosylase
This tRNA-guanine transglycosylase (tgt) catalyzes an exchange for the guanine base at position 34 of many tRNAs; this nucleotide is subsequently modified to queuosine. The Archaea have a closely related enzyme that catalyzes a base exchange for guanine at position 15 in some tRNAs, a site that is subsequently converted to the archaeal-specific modified base archaeosine (7-formamidino-7-deazaguanosine), while Archaeoglobus fulgidus has both enzymes. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129522
View PSSM: TIGR00430
Aligned: 7 rows
Threshold Bit Score: 597.087
Threshold Setting Gi: 3122931
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8928434    2 FSVIKNDKHfnARVGFLNLPHG----RVDIPCFMPVGTLGAMKGLKHAVLEKLE-CNLMLANTYHLYLRLGIKTVEKYVG 76
gi 20095247   3 FELDTTDGR--ARRGRLVFDRG----VVETPCFMPVGTYGTVKGMTPEEVEATG-AQIILGNTFHLWLRPGQEIMKLHGD 75
gi 1174661    3 YELDKTSGN--ARRGRLVFERPqgtfSVETPAFMPVGTYGTVKGMTPEEVRATG-AEILLGNTFHLWLRPGQEVMRKHGD 79
gi 3122932    8 YEFIKECKQtgARLGKVHTPHG----SFETPVFMPVGTLATVKTMSPEELKAMD-AGIILSNTYHLWLRPGQDIVKEAGG 82
gi 3122931    5 FRIKHTLDR--MRVGKVKTRHG----SFETPVFIPVATLAAIRGLDNRDLKDMG-VEVILANTYHLHLRPGDELIKELGG 77
gi 2498995   10 YQCQARCSHsqARAGIFQTPHG----PVETPRFMPVGTLATVKGITPAQLADTQ-AQMVLANTYHLHLQPGEKIIAAAGG 84
gi 2498993    3 FQLQATDNN--ARAGLLNLAHS----QVATPVFMPVGTQGCIKSLDATDAQEILgAKLILANTYHMYLRPGEKVVEELGG 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8928434   77 LHNFTIWNKNFLTDSGGFRVFSFS----------------------DLRKIDLK----------GVHFKSHIDGSYHYFT 124
gi 20095247  76 LHDFMQWKGPILTDSGGFQVFSLG----------------------DIRKITEQ----------GVHFRNPINGDPIFLD 123
gi 1174661   80 LHDFMQWHRPILTDSGGFQVFSLG----------------------KLRKITEE----------GVKFQNPINGERIFLS 127
gi 3122932   83 LHKFMNWDRAILTDSGGFQVFSLS----------------------KFRNIEEE----------GVHFRNHLNGDKLFLS 130
gi 3122931   78 LHKFMNFDGVIVTDSGGFQAFSLGfgmehgvgkiannifleelreeRLREAENErkklavvtdrGVRFKDPKSGRIVELT 157
gi 2498995   85 VHKFMGWSGPMLTDSGGFQVFSLS----------------------QLRTIGEQ----------GVLFRSPRDGRLIDMT 132
gi 2498993   77 LHRFAQFYGSFLTDSGGFQAFSLS----------------------DNVKLQED----------GIVFKSHIDGSKHLFT 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8928434  125 SEGIFAMQEIFGSDIIMPLDICSSYGIDYNEANLYTNITTNWASSTFKSSKNRKegYNGLLFLITQGNFFKDLRKRSIND 204
gi 20095247 124 PEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLG--NKNALFGIIQGSVYEDLRDISVKG 201
gi 1174661  128 PEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRDRFDELG--NKNALFGIIQGGVFEELRKVSLEG 205
gi 3122932  131 PEKAMEIQNALGSDIMMAFDECPPYPAEYDYMKRSVERTSRWAERCLNAHNRQ---DEQGLFGIVQGGEYEDLRTQSAKD 207
gi 3122931  158 PKKSMEIQSNLGSDIIFAFDECTSPLSDRDYTEKALERTHRWAEECLQHYDRR-----QALFGVVQGGEYRDLREKSARF 232
gi 2498995  133 PENSIRIQNALGADVIMAFDECPPGQGDRLMVEQATARTYRWLERCIEAHQRP---GDQALFGIVQGGTYLDLRSQAAEQ 209
gi 2498993  125 PAKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESIKRSAKWANMSLEYHKEKNr-PSNNLFAIIQGGTHLKMRSL-SVG 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8928434  205 ILELDSPGIAIGGiSVGEPREKYLEILEYSFLLIPKEKPRYVMGIGTPHYILNAIYYGIDIFDCFNPARITRHGSLLTD- 283
gi 20095247 202 LVDIGFDGYAVGGlAVGEPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVT- 280
gi 1174661  206 LVNIGFDGYAVGGlAVGEPKEDMHRILEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVT- 284
gi 3122932  208 LISLDFPGYAIGGlSVGEPKDVMNRVLEFTTPLLPKDKPRYLMGVGSPDALIDGAIRGVDMFDCVLPTRIARNGTVFTA- 286
gi 3122931  233 MAERDFAGYGIGG-SLGKSKQDMLNILDWVIPLLPEEKPRHLLGIGAIEDLFNCTEKGVDMYDCVAPARWARRGHLYVSp 311
gi 2498995  210 LIALDLPGYAIGGvSVGEAPALIDKVVQHTAPLLPAHKPRYLMGVGTYREMARAIFAGIDLFDCVIPTRFGRHGTALVQ- 288
gi 2498993  203 LTHEGFDGYAIGGlAVGESADEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAISLGVDMFDCVMPTRNARNATLFTH- 281
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8928434  284 -NG-------IMCIGRKEYKDDTSKVEKNCICTLCKRYSRGYLRHLIKSKELFGIVLASEHNIHYMFRLISKIRAAILND 355
gi 20095247 281 -DG-------VVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEG 352
gi 1174661  285 -DG-------IVKIRNAKYRDDTSPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAEIRQAIEDD 356
gi 3122932  287 -EG-------RLNMKNAKFERDFRPIDEECDCYTCKNYTRAYIRHLIRCNETFGLRLTTYHNLHFLLHLMEQVRQAIRED 358
gi 3122931  312 aEGgnvrnkfRIHIKNAAFRIDNRPVDRTCDCLVCQNYSRAYLRHLYKANELLYFRLATYHNIYFVVKLMERIRESIADG 391
gi 2498995  289 -GE-------RWNLKNATFREDHRPLDETCPCYTCQTFSRAYLNHLIRSREMLGYILLSLHNITELIRFTQSIRQAILND 360
gi 2498993  282 -SG-------KISIKNAPYKLDNTPIEENCACYACKRYSKAYLHHLFRAKELTYARLASLHNLHFYLELVKNARNAILEK 353
                       410
                ....*....|....*...
gi 8928434  356 DFLNFRTSYLKKYEEENF 373
gi 20095247 353 KLESFVTDFYQRQGREVP 370
gi 1174661  357 RFDDFVVEFYARMGKPVP 374
gi 3122932  359 RLGDFREEFFERYGYNKP 376
gi 3122931  392 ---SFYELKREWLGF--- 403
gi 2498995  361 ---TFTQDFAH---WLTP 372
gi 2498993  354 RFLSFKKEFLEKYNSRSH 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap