1K8W


Conserved Protein Domain Family
TruB

?
TIGR00431: TruB 
Click on image for an interactive view with Cn3D
tRNA pseudouridine(55) synthase
TruB, the tRNA pseudouridine 55 synthase, converts uracil to pseudouridine in the T loop of most tRNAs in all three domains of life. This model is built on a seed alignment of bacterial proteins only. Saccharomyces cerevisiae protein YNL292w (Pus4) has been shown to be the pseudouridine 55 synthase of both cytosolic and mitochondrial compartments, active at no other position on tRNA and the only enzyme active at that position in the species. A distinct yeast protein YLR175w, (centromere/microtubule-binding protein CBF5) is an rRNA pseudouridine synthase, and the archaeal set is much more similar to CBF5 than to Pus4. It is unclear whether the archaeal proteins found by this model are tRNA pseudouridine 55 synthases like TruB, rRNA pseudouridine synthases like CBF5, or (as suggested by the absence of paralogs in the Archaea) both. CBF5 likely has additional, eukaryotic-specific functions. The trusted cutoff is set above the scores for the archaeal homologs of unknown function, so yeast Pus4p scores between trusted and noise. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129523
View PSSM: TIGR00431
Aligned: 8 rows
Threshold Bit Score: 308.144
Threshold Setting Gi: 6136050
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1K8W_A       24 INGVLLLDKPQGMSSNDALQKVKRIYNANRAGHTGALDPLATGMLPICLG-EATKFSQYLLDSDKRYRVIARLGQRTDTS 102
gi 13959588   8 IEGVLLVDKPQGRTSFSLIRSLVRLIGVKKIGHAGTLDPFATGVMVMLIGrKFTRLSDIMLFEDKEYAAVAHLGTTTDTY 87
gi 140741    11 INGVLLLDKPQGMSSNDALQKVKRIYNANRAGHTGALDPLATGMLPICLG-EATKFSQYLLDSDKRYRVIARLGQRTDTS 89
gi 1174805   11 VDGVFLLDKPQGMSSNDIMQKVKRLFQANKAGHTGALDPLATGMLPICLG-EATKFSQFLLDADKRYLVTAKLGERTDTS 89
gi 2498045    1 MFGFLNLHKPLHLTSHDCVAKVRRLLRQKRVGHGGTLDPLAEGVLPLAVG-SATRLLPYLP-GAKQYQALIRFGVRTDSD 78
gi 3915166    2 ENGFLLINKEQGKTSFETLFPIKKYFNTNRVGHAGTLDKFASGILVCLVG-KYTKLSGYFTSLDKEYVAEFRFGLETDTL 80
gi 6136050    7 PDAIVPFAKVSGLTSFAALAQVRRLLGVKKVGHTGTLDRFADGLLLLLVG-GFTKLAPVMTRLEKSYEARIQFGVQTDTL 85
gi 3183559    2 VNGVLLLHKPVGMTSHDCVMKIRKLLKTKKVGHTGTLDPEVSGVLPICVG-RATKIVEYLTEKSKTYDAEITLGFSTTTE 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1K8W_A      103 DADGQIVEERPVTFSAE--QLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYeLLFI------ 174
gi 13959588  88 DCDGKIVGRSKKVPTMD--EVLTCTSYFQGEIQQVPPMFSAKKVQGKKLYEYARQGLSIERRFATVTVN-LRLV------ 158
gi 140741    90 DADGQIVEERPVTFSAE--QLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYeLLFI------ 161
gi 1174805   90 DAEGQVVETREVNLETQ--QILTALEQFRGDILQVPTMFSALKHNGKPLYEYARQGITVEREARPITIFeLNFI------ 161
gi 2498045   79 DLAGEVLESKNVSYLTLa-AVEQILPTFLGEIEQIPPQYSAIQVNGKRLYELARAGIPQAVPSRMVTINdLKILgw---- 153
gi 3915166   81 DPNGRIVSKTDYIPNVE--DIDLKLKDFVGEIYQSPPRFSSVHIDGSRAYKLALNGKFFEIKKRKVTVYnIQRLs----- 153
gi 6136050   86 DPEGAVVR-CSLFPTFA--RVRAALPHFTGSIDQVPPEYSALKFGGVRASDRVRRGEAVCMKARRVFVFdLQVLgceadl 162
gi 3183559   81 DQTGETVETKPVNHDIDkaDVEKVLNSLKGKQEQIPPMYSAVKVNGKKLYEYARAGIEVERPKRMITIEdIALTte---- 156
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
1K8W_A      175 ---RHEGN---------------ELELEIHCSKGTYIRTIIDDLGEKLGCGAHVIYLRRLAVSKYPVERMVTLEHL 232
gi 13959588 159 ---KYEYP---------------RLHFVVQCSKGTYIRSIAHELGNMLGCGAYLEELRRLRSGSFSIDQCIDGNLL 216
gi 140741   162 ---RHEGN---------------ELELEIHCSKGTYIRTIIDDLGEKLGCGAHVIYLRRLAVSKYPVERMVTLEHL 219
gi 1174805  162 ---EYNAP---------------FLTLEVHCSKGTYIRTLVDDLGEVLGCGAHVTMLRRTAVADYPVAEMMPINEL 219
gi 2498045  154 --rSGNQP---------------ELDLQVTCGEGTYIRALARDLGDRLGTGATLAGLVRQQSGGMALDNSVGLTAL 212
gi 3915166  154 ----YDFSs-------------sLLSLKISCSKGTYIRSIARDLAYSLNSCAYVSNLKRTKVGMFRLKDSTLCENL 212
gi 6136050  163 gefKKTQAgrgaaiadldltrvrAVTLYVRCSAGFYVRALARDIAAACGSCAYVSHLRRTRIGPFDLAQAAGVSRL 238
gi 3183559  157 --iKHHGEt-------------aSFRFTVTCSKGTYVRTLAVMIGEKLGYPAHMSHLIRTASGDFSLDECFTFDEL 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap