1EGA


Conserved Protein Domain Family
era

?
TIGR00436: era 
Click on image for an interactive view with Cn3D
GTP-binding protein Era
Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein. [Protein synthesis, Other]
Statistics
?
PSSM-Id: 129528
View PSSM: TIGR00436
Aligned: 8 rows
Threshold Bit Score: 340.52
Threshold Setting Gi: 3334175
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EGA_A       9 GFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQ-AIYVDTPGLHmEE-KRAINRLMNKAASSSI 86
gi 1169543  11 GFIAIVGRPNVGKSTLLNKILGQKISITSRKAQTTRHRIVGIKTEGAYQ-EIYVDTPGLH-IEeKRAINRLMNRAASSAI 88
gi 462020    9 GFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQ-AIYVDTPGLH-MEeKRAINRLMNKAASSSI 86
gi 1168646   9 GFVSIIGRPNVGKSTFLNRVIGQKIAIMSDKPQTTRNKVQGVLTTGTSQ-TIFIDTPGIH-KP-KHKLGDFMMKVAQNTL 85
gi 3334177  23 GFVAIVGRPNVGKSTLMNQLVGQKIAITSPVAQTTRNRLQGIITTPSSQ-IILLDTPGIH-KP-HHELGRVLVKNAIQAI 99
gi 3334175   4 GFAAILGRPSTGKSTLLNSICGHKISIISPIPQTTRNNIKGIFTDDRGQ-IIFIDTPGFH-LS-KKKFNIAMMKNIHSSI 80
gi 1352385   4 LKVGVLGPTNAGKSTLINFLHNDDSLMVSSMNNTTLLSISTEVINQANKnIVFIDVPGFT-EK-KHSNYELITKEIRKAL 81
gi 2495117   4 IRIGVLGLTNAGKSTLVNQLHKANNLLVSPMNNTTLLAVSTNTITHEKQnITFIDVPGFS-EK-RHSSYELISQEIRKAL 81
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EGA_A      87 GDVELVIFVVEGTRWTPDd-EMVLNKLREGKAPVILAVNKVDNvQ-EKADLLPHLQFLASQMNFL--DIVPISAETGLNV 162
gi 1169543  89 GDVDLIIFVVDGTHWNADd-EMVLNKLRNAKAPVVLAINKVDN-IkNKDDLLPFITDLSSKFNFA--HIVPISAQRGNNV 164
gi 462020   87 GDVELVIFVVEGTRWTPDd-EMVLNKLREGKAPVILAVNKVDN-VqEKADLLPHLQFLASQMNFL--DIVPISAETGLNV 162
gi 1168646  86 KEVDLILFMINAEEGYGKgdEFIIEKLQTMSTPVFLIVNKIDK-I-HPDQLLLLIDEYRKRYPFK--EIVPISALEGNNI 161
gi 3334177 100 HSVDLVVFLVDSSATLGRgdRFVVDLLQKTDGPVVVGLNKQDQ-Q-PPDQREELNASYETLTENHgwPCFKFSALTGEGL 177
gi 3334175  81 GEVELILYIIDIQDKPGEeeNKMLEIIKNSKIKFLVILNKIDL-KnTKIKEITQFLKEKGIEDS---NIIKISAEKKINT 156
gi 1352385  82 SGIDVLLLVVRSDQNNKI--EFLKTQLQQLKRYQNLTRIFLIN-K-FHQKSLSEVNKAIILEEFKpqKTIEINLLKFDKN 157
gi 2495117  82 SGIDVLLLVVRSDQQQKL--PLLQTQLQPLKRYRDLTRVLLIN-N-FFDVVLQAEDKQAIVLDFKpqAVLETDLLHFDAT 157
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EGA_A     163 DTIAAIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVSN-ERGGYDINGLILVEREG 241
gi 1169543 165 HELEKIVRQSLREGVHHFPEDYVTDRSQRFMASEIIREKLMRFTGEELPYSVTVEIEQFKVN-ERGTYEINGLILVEREG 243
gi 462020  163 DTIAAIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVSN-ERGGYDINGLILVEREG 241
gi 1168646 162 ETLLAQIEAYLPEGPQFYPSDQVTDHPERFIISELIREKVLHLTREEIPHSIAVAIESIKGQ-DNGSVHVAATIVVERDS 240
gi 3334177 178 SNFQSALEARLDPGPYYYPPDLVTDQPERFIMAELIREQILLLTRQEVPHSVAIAIEKVEET-PER-TNVFAAITVERGS 255
gi 3334175 157 EELKNKIYENFSEGPLYYPQEYYTDQEINFRISEIIREKAIEnLKEELPY--SLYVDIDTLEnKKGSLFIRANIFVANES 234
gi 1352385 158 LFWSIFKQVELRYNIFRKDINFIDANNDDFKILEGLREQIIFYCKNEIPHIARIEIIEKSFNkEKNLLKIHLVISVPKLS 237
gi 2495117 158 SFWNQFNEVKLQANEFRKDVEFLDADTDNFKILEALREQIIKYCSEEIPHVVRLEIVDKSFDqAKNLLKLHLSISVPKLS 237
                      250       260       270
               ....*....|....*....|....*....|....*....
1EGA_A     242 QKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVK 280
gi 1169543 244 QKKMVIGAGGQKIKTIGMEARADMERLFDNKVHLELWVK 282
gi 462020  242 QKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVK 280
gi 1168646 241 QKGIVIGKKGSLLKEVGKRARADIEALLGSRVYLELWVK 279
gi 3334177 256 QKGIIIGQKGSMLQAIGTAARQQIQKLISGDVYLKLFVK 294
gi 3334175 235 QKGIIVGKNGKEIKSIGERARKTIAKIFETKCNLFLQVK 273
gi 1352385 238 QKKIIIGKNAEMIKAIGIATRKKLLNHFDCDIFIDIFVK 276
gi 2495117 238 QKKIIIGRNAQMVKKIGMQMRQKLLEYYDCNVFVELFVR 276
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap