2I22


Conserved Protein Domain Family
gmhA

?
TIGR00441: gmhA 
Click on image for an interactive view with Cn3D
phosphoheptose isomerase
This model describes phosphoheptose isomerase. Because a closely related paralo in Escherichia coli differs in function (DnaA initiator-associating protein diaA), this model has been rebuilt with a high stringency, and is likely to miss many true examples for phosphoheptose isomerase. Involved in lipopolysaccharide biosynthesis it may have a role in virulence in Haemophilus ducreyi. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129533
View PSSM: TIGR00441
Aligned: 5 rows
Threshold Bit Score: 284.449
Threshold Setting Gi: 159794805
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2I22_A      54 AVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAIS-DVSHISCVGNDFGFNDIFSRYVEAVGREG 132
gi 7387837  32 VHLLIETLENQGKILICGNGGSASDAQHFAAELTGRYKLERKGLSAISLNtDISALTAIANDYGYEEVFARQVEALGVKN 111
gi 1176821  34 ALLISNSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAIS-DASHLSCVSNDFGYEYVFSRYVEAVGQKG 112
gi 1708000  34 AVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAIS-DVSHISCVGNDFGFNDIFSRYVEAVGREG 112
gi 7387842  28 VDLICQRFQAGNKLLICGNGGSAADAQHLAAEFVGRFHFNRQALPAIALTaNSSILTSVSNDYTYDIVFSRQVEALGQPG 107
                       90       100       110       120       130       140       150
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
2I22_A     133 DVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFgYADRIQEIHIKVIHILIQLIE 207
gi 7387837 112 DVLIGISTSGNSKNVLKAYEKAKDLEMKTLSLAGRDGGKMKPLSDMALIVPSD-DTPRIQEMHILMIHILCDCIE 185
gi 1176821 113 DVLFGLSTSGNSKNILNAIEAAKTKGMKVIAMTGKDGGKMAGLADVEIRVPHFrYADRIQEIHIKVIHILMMLIE 187
gi 1708000 113 DVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFgYADRIQEIHIKVIHILIQLIE 187
gi 7387842 108 DILWGLSTSGKSTNVLHALKCAKDKGLHTIGMAGNNGGLFQEFADYPLFVADK-NTPCIQEVHLMTYHHICEQVE 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap