1GO3,2CKZ


Conserved Protein Domain Family
rpoE

?
TIGR00448: rpoE 
Click on image for an interactive view with Cn3D
DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form
This family seems to be confined to the archea and eukaryotic taxa and are quite dissimilar to E.coli rpoE. [Transcription, DNA-dependent RNA polymerase]
Statistics
?
PSSM-Id: 129540
View PSSM: TIGR00448
Aligned: 6 rows
Threshold Bit Score: 266.265
Threshold Setting Gi: 11498717
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GO3_E         1 MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPE 80
gi 2500642     1 MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPE 80
gi 499181073   1 MYARIKLRDTVRVPPSKLGEDIEKVINSLLWEQFEGRLDREYGMIIGIESIEEIGEGRIIEGDGGVYFDVVFNAICFRPL 80
gi 499178363   1 MYYVTKIVDTVRIPPDRFEEPLEEVAVEVLNETYVGRMDKNLGQLITVKEIEDIGIGKVIMGDGAAYHEVTFTALFFKPE 80
gi 549722      1 MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPF 80
2CKZ_B         1 MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GO3_E        81 MYELIEGEVVDVVEFGSFVR-LGPLDGLIHVSQIMDDYVSYDPKREAIIG---KETGKVLEIGDYVRARIVAISLKAERK 156
gi 2500642    81 MYELIEGEVVDVVEFGSFVR-LGPLDGLIHVSQIMDDYVSYDPKREAIIG---KETGKVLEIGDYVRARIVAISLKAERK 156
gi 499181073  81 HQEVVEGEVIEIVEFGAFVS-IGPFDALLHMSQVTDDYMVFDEKNKRLVG---RETKKVLQEGDKVRARIVSLSLKEREP 156
gi 499178363  81 LHEIVEGEVIEIAEFGAFVR-IGPVDGLVHVSQVTDDYITYDPKKGSLTG---KESGRRLDEGDLVRARIVALSLKGRR- 155
gi 549722     81 LGEIVTGWISKCTAEGIKVSlLGIFDDIFIPQNMLFEGCYYTPEESAWIWpmdEETKLYFDVNEKIRFRIEREVFVDVKP 160
2CKZ_B        81 LGEIVTGWISKCTAEGIKVSlLGIFDDIFIPQNMLFEGCYYTPEESAWIWpmdEETKLYFDVNEKIRFRIEREVFVDVKP 160
                        170       180
                 ....*....|....*....|....
1GO3_E       157 -RGSKIALTMRQPYLGKLEWIEEE 179
gi 2500642   157 -RGSKIALTMRQPYLGKLEWIEEE 179
gi 499181073 157 -EKSKIGLTMRQPWLGALKWIEEE 179
gi 499178363 156 -EGVKVGLTMRQPGLGKFEWIEEE 178
gi 549722    161 kSPKERELEERAQLENEIEGKNEE 184
2CKZ_B       161 kSPKERELEERAQLENEIEGKNEE 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap