3K8D,1VIC


Conserved Protein Domain Family
kdsB

?
TIGR00466: kdsB 
Click on image for an interactive view with Cn3D
3-deoxy-D-manno-octulosonate cytidylyltransferase
[Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129558
View PSSM: TIGR00466
Aligned: 3 rows
Threshold Bit Score: 381.57
Threshold Setting Gi: 7387816
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K8D_A      20 VVIIPARYASTRLPGKPLVDINGKPMIVHVLERAResGAERIIVATDHEDVARAVEAAGGEVCMTRADHQSGTERLAEVV 99
gi 7387816   1 MIIIPARLKSSRFENKVLEDIFGLPMVVRCAKNAN--LVDECVVACDDESIMQTCQKFHIKAVLTSKHHNSGTERCLEAA 78
1VIC_A       4 TVIIPARFASSRLPGKPLADIKGKPMIQHVFEKALqsGASRVIIATDNENVADVAKSFGAEVCMTSVNHNSGTERLAEVV 83
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K8D_A     100 EKCAFSDDTVIVNVQGDEPMIPATIIRQVADnlAQRQVGMATLAVPIHNAEEAFNPNAVKVVLDAEGYALYFSRATIPWD 179
gi 7387816  79 RILGLKNDERVLNLQGDEPFLEKEVILALLE--ATKNAPFMATCAKVIDEEQAKSPNLVKVVLDSQNNALYFSRSLIPFL 156
1VIC_A      84 EKLAIPDNEIIVNIQGDEPLIPPVIVRQVADnlAKFNVNMASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYD 163
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K8D_A     180 RDRFAEGLETvg----dnFLRHLGIYGYR-AGFIRRYVNWQPSPLEHIEMLEQLRVLWYGEKIHVAVAQEVpGTGVDTPE 254
gi 7387816 157 RDFDAKRQTP--------LLGHIGIYGFHnKEILEELCALKPCVLEEIEKLEQLRALYYQKKIAVKIVQSE-SVGIDTQE 227
1VIC_A     164 RDQFMNLQDVqkvqlsdaYLRHIGIYAYR-AGFIKQYVQWAPTQLENLEKLEQLRVLYNGERIHVELAKEVpAVGVDTAE 242

               ...
3K8D_A     255 DLE 257
gi 7387816 228 DLQ 230
1VIC_A     243 DLE 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap