2BH2


Conserved Protein Domain Family
rumA

?
TIGR00479: rumA 
Click on image for an interactive view with Cn3D
23S rRNA (uracil-5-)-methyltransferase RumA
This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family. The member from E. coli has now been shown to act as the 23S RNA methyltransferase for the conserved U1939. The gene is now designated rumA and was previously designated ygcA. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129571
View PSSM: TIGR00479
Aligned: 6 rows
Threshold Bit Score: 634.553
Threshold Setting Gi: 62738954
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BH2_A        24 LDSFGQGVARHNGKTLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRS 103
gi 489326596  20 LTHEGAGVAKVQGFPIFVPNALPEEKAQIKVTRVKKGFAFGRLIELKEESPHRTDAPCPIYKQCGGCQLQHMTYEGQLLF 99
gi 657203034  25 LGINGEGVGYFKKKVVFVPGALPGEEVVVQATKVQPKFSEGRIKKIRKASEHRVAPPCPVYEQCGGCQLQHLAYSQQLRE 104
gi 499174448  26 LNHQGEGIGRFNERVVFVPDTAPGDRLEVRLVKVKRNYALAQLLKILEPSVQRTRPSCIVADKCGGCQWQHLDYQFQVES 105
gi 485791962  24 LDSFGQGVARHNGKTLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRS 103
gi 1723812    24 LDYQGLGVAKINGKTWFIENALPHEKVECRILEDKRQYGHAIVKKWRVKSPERLEPKCAHFMRCGGCQGQHIPIEMQRKA 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BH2_A       104 Ks---AALARLMKHDVSEVIADVP-------WGYRRRARLSLNYLPKTqqLQMGFRKAGSSDIVDVKQCPILAPQLEALL 173
gi 489326596 100 KqkqvKDVLERIGKLDLSKVTVHPtlgmedpWNYRNKAQVPVGEREGG--LVAGFYQQRSHDIIDMSACLIQQSKNDEAV 177
gi 657203034 105 KrdivIQSLERHTKFKVENMEIKEtigmdnpWNYRNKSQFQIGRSQSGs-IIAGLYGLDSHDIVPIKDCIVQHPATNKTT 183
gi 499174448 106 KqqqiIDALERIGGFTTLPLEPLLqsp--asLGYRNKATYPLSRSKTGq-VQAGYYRKGSHRLVNINQCPVQDDRLNLLL 182
gi 485791962 104 Ks---AALARLMKHDVSEVIADVP-------WGYRRRARLSLNYLPKTqqLQMGFRKAGSSDIVDVKQCPILAPQLEALL 173
gi 1723812   104 Ke---SALFKRLSKLQSEPISFQPmic-gdaWAYRRRVRLSLWFNPSTkqIEMGFRQKNTNDLIPVQSCEVAEPAINYLL 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BH2_A       174 PKVRACLGSLQAMRHLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDs----------------- 236
gi 489326596 178 QAVKDICANYGVKAYNEERHKGWLRHIMVRYGVVTGEMMIVFITRTSDFPHKAKIIEDITAQfphvksivqninpnktnv 257
gi 657203034 184 GIVRRILEDFNVSVYNERKRKGDVRTIVTRVGFETGEVQVVLVTAKETLPHKEEIVKAIQKRlpevksiiqnvngaktsv 263
gi 499174448 183 TEVKKDIENRGWSIYDEEKKQGKLRHLSLRIGQRTGEMLLTLISAHKGLPDLEEQAGEWLERypdlggiclniqpepnnr 262
gi 485791962 174 PKVRACLGSLQAMRHLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDs----------------- 236
gi 1723812   180 PKLTALLEKFSAPKQLGHIELVAADNGVAMLLRYTKNLAEIDRTLLLKFAEQEKLMLFLQSD------------------ 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BH2_A       237 ---EILETVSGEMPWYD-SNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVV 312
gi 489326596 258 ifgNETNVIWGEEYIYDlIGDVKFAISARSFYQVNPEQTKVLYDKALEYAELQGEETVIDAYCGIGTISLFLAKQAKKVY 337
gi 657203034 264 ifgEKTKQLAGKTVIQEvLGDVSFELSARAFFQLNPEQTVKLYDEVKKAAQLTGKEKVVDAYCGVGTIGMWVADGAKEVR 343
gi 499174448 263 ifgDETVVIAGRGICREkFADLSFSLGANTFFQVNSGAAELLLTRLQQALNLQGAELLVDAYAGVGTFTLPLARQVRQAI 342
gi 485791962 237 ---EILETVSGEMPWYD-SNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVV 312
gi 1723812   242 ---KGIEQIYGDAPYYQfSDGIKLHFDIRDFIQVNSALNEPMVNTALDWLELSQQDCVLDLFCGMGNFTLPLAKRVKSAV 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BH2_A       313 GVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDPARAG-AAGVMQQIIKLEPIRIVYVSCNP 391
gi 489326596 338 GVEIVPEAIEDAKRNAELNGNTNAEFAVGEAETVIPKWYEEGITADTLVVDPPRKGcDEALLRTIVEMKPKRVVYVSCNP 417
gi 657203034 344 GMDVIKESIDDAKKNAKKHGMANATYVTGTAEHWLPKWTKEGFRPDVVIVDPPRTGcDSTFLDTIKKVKPKRFVYVSCNP 423
gi 499174448 343 AIEVNQDSVHQGQRNAEINQIANVDFLAGTVETVLPTLSE---IPDVLLLDPPRKGcAPEVLREIIRQRPEKIAYISCQP 419
gi 485791962 313 GVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDPARAG-AAGVMQQIIKLEPIRIVYVSCNP 391
gi 1723812   319 GIEGVFEMVQKAAQNAERNQIKNIEFFQADLDQSFVEQPWANQSFNKILLDPPRSG-AAFALNALCELKAEKILYVSCNP 397
                        410       420       430
                 ....*....|....*....|....*....|....
2BH2_A       392 ATLARDSEALLKAG-YTIARLAMLDMFPHTGHLE 424
gi 489326596 418 GTLARDLRVLEDGG-YVTREVQPVDMFPHTNHVE 450
gi 657203034 424 STLAKDLQTLSKD--YRVDYIQPVDMFPQTAHVE 455
gi 499174448 420 PTLARDLKFLCAEGfYGITWVQGCDFFPQTAHVE 453
gi 485791962 392 ATLARDSEALLKAG-YTIARLAMLDMFPHTGHLE 424
gi 1723812   398 ATLVRDAEILCNFG-YKIEKSAVIDMFPHTGHLE 430
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap