2RDO


Conserved Protein Domain Family
EF-G

?
TIGR00484: EF-G 
Click on image for an interactive view with Cn3D
translation elongation factor EF-G
After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129575
View PSSM: TIGR00484
Aligned: 7 rows
Threshold Bit Score: 1191.92
Threshold Setting Gi: 3915665
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7         1 MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVH--DGA-ATMDWMEQEQERGITITSAATTAFWSGmak 77
gi 2494252     1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETH--DGE-SVMDWMEQEKERGITITSAATSVSWKN--- 74
gi 3915665     1 ----MDYNKLRNIGISAHIDSGKTTLTERILFYCNKIHAIHEVKgkDGVgATMDSMELERERGITIASAATHVEWKD--- 73
gi 1352348     1 MSRTVDLKNFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETH--DGE-SVMDWMEQEKERGITITSAATSVSWKN--- 74
gi 446023959   1 MARKTPLNRIRNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVH--DGA-ATMDWMEQEKERGITITSAATTCFWKD--- 74
gi 499171424   1 MARTTPIERYRNIGISAHIDAGKTTTTERILFYTGVSHKIGEVH--DGA-ATMDWMEQEQERGITITSAATTAFWSGmsq 77
gi 1644223     1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETH--EGA-SQMDWMEQEQERGITITSAATTAQWKG--- 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7        78 qyepHRINIIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVNQ 157
gi 2494252    75 ----CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQS 150
gi 3915665    74 ----FPINIIDTPGHVDFTIEVERSLRVLDGAILVLDSVAGVQSQSITVDRQLKRYSVPRLAFVNKCDKTGANPYNVKDQ 149
gi 1352348    75 ----CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRVIFVNKMDKTGANFERSVLS 150
gi 446023959  75 ----HQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVENQ 150
gi 499171424  78 qfpqHRINVIDTPGHVDFTVEVERSMRVLDGAVMVYCAVGGVQPQSETVWRQANKYEVPRIAFVNKMDRTGANFLRVVEQ 157
gi 1644223    75 ----YRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGT 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7       158 IKTRLGANPVPLQLAIGAEEHFTGVVDLVKMKAINWNdADQGVTFEYEDIPADMVELANEWHQNLIESAAEASEELMEKY 237
gi 2494252   151 IQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD-GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADY 229
gi 3915665   150 LRSKLDLNSVLMQIPIGLEDKHIGVIDLVLMKAYYFE-GKDGTEIIEKEIPSDLLEEAKSKREIMLDTLADFNDELMELH 228
gi 1352348   151 IQQRLGVKAVPIQFPIGAENDFNGIIDIITKKAYFFD-GNKEENAIEKPIPEQYVDQVEKLYNNLVEEVASLDDQLMADY 229
gi 446023959 151 IKLRLKANPVPINIPIGAEDTFIGVIDLVQMKAIVWNnETMGAKYDVEEIPSDLLEKAKEYREKLVEAVAEQDEALMEKY 230
gi 499171424 158 LKTRLGANAIPLQLPVGAEENFTGVVDLIKMKAINWNeADQGMTFTYEEVPANMQADCEEWRQNLVEAAAEASEELMEKY 237
gi 1644223   151 LRDRLQANAHAIQLPIGAEDNFEGIIDLVENVAYFYE-DDLGTRSDAKEIPEEYKEQAEELRNSLIEAVCELDEELMDKY 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7       238 LGGEELTEAEIKGALRQRVLNNEIILVTCGSAFKNKGVQAMLDAVIDYLPSPVDVPAINGILDDgkDTPAERHASDDEPF 317
gi 2494252   230 LEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED--GNEVLISASDDAPF 307
gi 3915665   229 MEGKEVPTEIIYNATRTGTLALKLCPVFMGSAYKNKGVQLLLDAVTRFLPSPHDIKN-TALDLNnnEKEIDLKIDNELPT 307
gi 1352348   230 LDGKPIEIDAIKNAIRNGVIHCKFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPPAKAIDAN--NKEISIKASDDANF 307
gi 446023959 231 LGGEELSIEEIKKGIKAGCLNMSLVPMLCGSSFKNKGVQTLLDAVIDYLPAPTEVVDIKGIDPKt-EEEVFVKSSDDGEF 309
gi 499171424 238 LGGEDLTEEEIKSALRQRVLANEIILVTCGSAFKNKGVQAMLDAVVEYLPAPTDIPAIKGINPD--ETEGERHASDEEPF 315
gi 1644223   230 LEGEELTIDELKAGIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAPTDVAAIKGTRPDt-NEEIERHSSDEEPF 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7       318 SALAFKIATDPFVGNLTFFRVYSGVVNSGDTVLNSVKAARERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTL 397
gi 2494252   308 VGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETL 387
gi 3915665   308 VALAFKLEDGQYG-QLTYVRIYQGILKKGQELINSRTSKKFKVGRLIRMHANNTEDIEFGGSGDIVALFGIECAS-GDTF 385
gi 1352348   308 IGLAFKVATDPFVGRLTFIRVYAGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIDEIRAGDICAVIGLKDTTTGETL 387
gi 446023959 310 AGLAFKIMTDPFVGQLTFVRVYRGKLESGSYVYNSTKDKKERVGRLLKMHSNKREDIKEVYAGEICAFVGLKDTLTGDTL 389
gi 499171424 316 SSLAFKIATDPFVGNLTFFRVYSGVINSGDTVLNSVRQKRERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTL 395
gi 1644223   309 SALAFKVMTDPYVGKLTFFRVYSGTLDSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTL 388
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7       398 CDPDAPIILERMEFPEPVISIAVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREF 477
gi 2494252   388 VDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREF 467
gi 3915665   386 CDPSINYSMTSMFIPDPVISLSVKPKDKKSADNMAKALGRFTKEDPTFKTYVDIESNETIIQGMGELHLEVYIERMKREF 465
gi 1352348   388 TDDKLDVQLEAMQFAEPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFSDPETGQTIIAGMGELHLDILVDRMKREF 467
gi 446023959 390 CDEKNAVVLERMEFPEPVIHIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKREF 469
gi 499171424 396 CAIDAPIILERMEFPEPVISVAVEPKTKADQEKMGLALGRLAQEDPSFRVHTDEESGETIISGMGELHLDIIVDRMKREF 475
gi 1644223   389 CDEKDLVILESMEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLDIIVDRMKREF 468
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7       478 NVEANVGKPQVAYRETIRQKVTdVEGKHAKQSGGRGQYGHVVIDMYPLEpgsnP--K--GYEFINDIKGGVIPGEYIPAV 553
gi 2494252   468 KVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEPNK----D--K--GFEFVDKIVGGRIPREYIKPV 538
gi 3915665   466 KAEVETGMPQVAYRETITRKAE-FNYTHKKQSGGAGQFGRVAGFMEPLD----KegE--TYEFVNLIKGGVIPTEYIPSC 538
gi 1352348   468 KVEVNIGAPQVSFRETFKSTSE-VEGKYIKQSGGRGQYGHVKIRFEPNK----D--K--GFEFVDKIVGGRIPREYIKPV 538
gi 446023959 470 KVEAEIGQPQVAFRETIRSSVS-KEHKYAKQSGGRGQYGHVFIKLEPKE----P--Gs-GYEFVNEISGGVIPKEYIPAV 541
gi 499171424 476 KVEANIGKPQVSYRETIRTRVNdVEGKHAKQSGGRGQYGHVVIDLYPLD----P--EgpGYEFVNEIKGGVIPGEYIPAV 549
gi 1644223   469 KVEANVGAPQVAYRETFRTGAK-VEGKFVRQSGGRGQFGHVWIEFEPNE----E--Ga-GFEFENAIVGGVVPREYIPAV 540
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7       554 DKGIQEQLKAGPLAGYPVVDMGIRLHFGSYHDVDSSELAFKLAASIAFKEGFKKAKPVLLEPIMKVEVETPEENTGDVIG 633
gi 2494252   539 QAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMG 618
gi 3915665   539 DKGFQKAMERGTLIGFPIVDIKITINDGQYHIVDSSDIAFQLAAIGAFREAYEKAKPTILEPIMKVTLEGPTEFQGNMFG 618
gi 1352348   539 QTGLENAMNSGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKQCNPVLLEPIMAIEVTVPEQYFGDTMG 618
gi 446023959 542 DKGIQEAMQNGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKEASRAANPVLLEPMMKVEVEVPEEYMGDVIG 621
gi 499171424 550 DKGIQEQLKSGPLAGYPVVDLGVRLHFGSYHDVDSSELAFKLAASLAFKAAFSKANPVLLEPIMKVEVETPPEYVGDVIG 629
gi 1644223   541 QAGLEDALENGVLAGFPLIDIKAKLFDGSYHDVDSNEMAFKVAASMALKNAVSKCNPVLLEPIMKVEVVIPEEYMGDIMG 620
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RDO_7       634 DLSRRRGMLKGQESEVTGVKIHAEVPLSEMFGYATQLRSLTKGRASYTMEFLKYDEAPSNVAQAVIEARG 703
gi 2494252   619 DISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688
gi 3915665   619 LLNQRRGIITGSLEDGSFSKVEAEVPLSEMFGFSTVLRSSTQGKAEFSMEFLRYGKVPSTIFDELRKKFN 688
gi 1352348   619 DISSRRGIIEGTEQRDNVQLIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIANKK 688
gi 446023959 622 DLNRRRGQINSMDDRLGLKIVNAFVPLVEMFGYSTDLRSATQGRGTYSMEFDHYGEVPSNIAKEIVEKRK 691
gi 499171424 630 DLSRRRAMVNGQEANEFVVKIYAEVPLSEMFGYATDLRSQTQGRASYSMEPLKYAEAPTSVAAAVIEARK 699
gi 1644223   621 DITSRRGRVEGMEARGNAQVVRAMVPLAEMFGYATALRSNTQGRGTFTMHMDHYGEVPKSVAEEIIKKNK 690
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap