Conserved Protein Domain Family
aEF-2

?
TIGR00490: aEF-2 
translation elongation factor aEF-2
This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129581
View PSSM: TIGR00490
Aligned: 3 rows
Threshold Bit Score: 1358.8
Threshold Setting Gi: 3122056
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248   3 KRAKMIAKIKELMEKYDRIRNIGICAHIDHGKTTLSDNLLAGAGMISKELAGEQLALDFDEEEAQRGITIFAANVSMVHT 82
gi 3122056   2 ARAKKVDKIKELMWKPKFIRNIGIVAHIDHGKTTLSDNLLAGAGMISEELAGQQLYLDFDEQEQERGITINAANVSMVHE 81
gi 7404354   3 RRAKMISKIKELMYQPEYIRNIGIVAHIDHGKTTLSDNLLAGAGMISAELAGDQRFLDFDEQEQARGITIDAANVSMVHS 82
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248  83 YEGNEYLINLIDTPGHVDFGGDVTRAMRAIDGAIVVVCAVEGVMPQTETVLRQALRERVKPVLFINKVDRLINELKLTPE 162
gi 3122056  82 YEGQDYLINLIDTPGHVDFGGDVTRAMRAVDGVIVVVDAVEGVMPQTETVLRQALKENVKPVLFVNKVDRLIKELELTPQ 161
gi 7404354  83 YEGNEYLINLIDTPGHVDFGGDVTRAMRAVDGAVVVVCAVEGIMPQTETVLRQALKENVRPVLFINKVDRLINELKLDAS 162
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248 163 ELQSRFIKIINDINNLIRKMAPEEFkDKWLVRVEDGSVAFGSAYNNWAISVPFMKKSGITFKDIIKYCEEDRQDELAEKA 242
gi 3122056 162 QMQERLIKVITEVNKLIKAMRPDKY-SEWKIDVANGSAAFGSALYNWAVSVPSQKKTGIGFKEVYEHIKEGKVKELAKKS 240
gi 7404354 163 ELQERFVKIIANANKLIKNMAPEEFrDKWQVRVEDGSVAFGSAYHNWAINVPIMQETGINFNDIYKYCTEDNQKELAQKV 242
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248 243 PLHEVVLDMVIKHLPSPPEAQKYRIPHLWKGDLNSEAGKAMLNCDPNGPLAGVITKIIVDKHAGAVSVCRLFSGRIKQGD 322
gi 3122056 241 PLYQVVLDMVIRHLPSPIEAQKERIAVIWKGDINSEVGKAMVNCDPKGPVALMITKIVVEPQAGEIAVGRLYSGTIRPGM 320
gi 7404354 243 PLHQVLLGMVVEHLPSPAESQAYRVPIIWSGDLESEEGQAMLKTDPEGPLAVMVTDVSIDKHAGEVATGRVYGGAIEKGS 322
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248 323 EVYMVNNQQKAKIQQVSVFMGPERIPVDSISAGNICALVGLKEASAGETiCSPDKIIEPFEAITHISEPVITVAIEAKNT 402
gi 3122056 321 ELYIVDRKAKNRIQTVGLYMGPRRVEVDEIPAGNIVAVIGLKDAVAGST-CTTVENLTPFESIKHYSEPVVTMAIEAKNP 399
gi 7404354 323 EVFLVGSHSKARVQQVGVYMGPERVNTDKVPAGNIVAITGAKNAVAGETiCDTGRKIKAFEGLEHISEPVVTVAVEAKNT 402
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248 403 KDLPKLIEVLRQVAREDPTVKVEINEETGEHLLSGMGELHIEIITKLKIERdAGIPVEVGQPIVVYRETVTGQSPVVESK 482
gi 3122056 400 RDLPKLIEVLRKLAKEDPTLHITLNEETGEHLISGMGELHLEVKVEKIRRD-YKLDVITSPPIVVFRETVTGTSPVVEGK 478
gi 7404354 403 KDLPKLIEVLRQVGKEDPTVRVEINEETGEHLISGMGELHLEIIAYRINEK--GVEIETSEPIVVYRETVAGTAGPVEGK 480
                      490       500       510       520       530       540       550       560
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248 483 SPNKHNKLYFVVEPLEESVLQAYKEGrIPDVDTKRKlddKIVQELIKAGMDPEEAKRVMCIYEGNVLINMTRGIVHLDEV 562
gi 3122056 479 SPNKHNRFYIVVEPLPEKVIQMFKEG-VVDMKMDKK---ERRRLLQEAGLTSEEAAGAEEYYEGNLFCDVTKGIQYLNET 554
gi 7404354 481 SPNKHNRFYIEIEPVEASVMQAIQEGkIKEGRVKGK---EMAKNFIEAGMDKEEARRVWDVYEKNLFINMTRGIQYLDEI 557
                      570       580       590       600       610       620       630       640
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248 563 KELIIQGFKEAMRNGPLAAEKCQGVKVKLMDAVLHEDAIHRGPAQMIPAARFGIRDAMMQANPVLLEPMQFVYINTPQDF 642
gi 3122056 555 MELILEGFREAMRAGPIAREPCMGIKVKLVDCKLHEDAVHRGPAQVIPAVRSAIFAAILQAKPALLEPYQKIFITVPQDM 634
gi 7404354 558 KELLMDGFESAMDNGPVAKEKVMGVKIKLMDAKIHEDAVHRGPAQVLPAIRKGIFGAMMSAEPVLLEPIQKVFINVPQDY 637
                      650       660       670       680       690       700       710       720
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494248 643 MGAAMREISNRRGQILDMEQEGDMAIIKAKCPVAEMFGFAGAIRGATQGRCLWSIEFAGYEKVPRDMQEQLIKQIRERKG 722
gi 3122056 635 MGAVTREIQGRRGQILEMKTEGDMVTIIAKAPVKEMFGFAGAIRGATSGKAIWSTEHAGFELVPQNLFQEFVMEVRKRKG 714
gi 7404354 638 MGSATREIQNRRGQIVNMTQEGDMVTVESTVPVAEMFGFAGDIRSATEGRCLWSTENAGFERLPNELQHTITREVRTRKG 717

               ....
gi 2494248 723 LKLE 726
gi 3122056 715 LKLE 718
gi 7404354 718 LSPE 721
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap