2P98


Conserved Protein Domain Family
met_pdase_I

?
TIGR00500: met_pdase_I 
Click on image for an interactive view with Cn3D
methionine aminopeptidase, type I
Methionine aminopeptidase is a cobalt-binding enzyme. Bacterial and organellar examples (type I) differ from eukaroytic and archaeal (type II) examples in lacking a region of approximately 60 amino acids between the 4th and 5th cobalt-binding ligands. This model describes type I. The role of this protein in general is to produce the mature form of cytosolic proteins by removing the N-terminal methionine. [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 129591
View PSSM: TIGR00500
Aligned: 9 rows
Threshold Bit Score: 373.992
Threshold Setting Gi: 16077836
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P98_A         2 ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQhAVSACLGYH------GYP---KSVCISI 72
gi 113740      3 ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQhAVSACLGYH------GYP---KSVCISI 73
gi 1703276    22 LVLLSARELDKMRRVGQLAANLLNHLESMVQPGVSTQALNDEATRWMEDHG-AISATLGYAp----pGYPpftGAICTSI 96
gi 3913033     4 LRLKSKDEIKKIKASASLLALTLLEVERNIVPGISTKELDLIAYDFIIKNR-AKPAFKGYR------GFK---GTICASV 73
gi 2497792     3 ISIKSPKEIKALRKAGELTAQALALLEREVRPGVSLLELDKMAEDFIKSSH-ARPAFKGLY------GFP---NSVCMSL 72
gi 1351928   127 IPIYKKDQIKKIRKACMLGREVLDIAAAHVRPGITTDELDEIVHNETIKRG-AYPSPLNYY------NFP---KSLCTSV 196
gi 1351927     2 IYLKSANEVAGIKKACAIFKAVKAYFTIEKLLGKKLVTIDRLIKQFIEQKQ-AKCAFHGYL------GFP---GFNCLSL 71
gi 489326401   1 MIVTNDQELEGLKKIGRIVALAREEMKRKAEPGMSTKDLDLIGKAVLDEHG-AVSAPEKEY------DFP---GVTCISV 70
gi 6647424     3 IELYSQREIEKIRKASQIVAEVLHIVAENVKPGVSTWDLEMIARKETEKRG-AKPAFLGYKppfsdvRYP---AALCISI 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P98_A        73 NEVVCHGIPD-DaKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGK-PTIMGERLCRITQESLYLALR-MVKPGINLREIG 149
gi 113740     74 NEVVCHGIPDdA-KLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGK-PTIMGERLCRITQESLYLALR-MVKPGINLREIG 150
gi 1703276    97 NEVVCHGIPNpK-QILKDGDIINIDVTLRLAGYHGDTSRTFLVGS-VSATARKLVEATQESMMRGIA-EIKPGARIGDIG 173
gi 3913033    74 NEEVIHGIPG-K-RKLADGDIVSIDCGVILDGFYSDMAKTFKVGN-VDSSIDKLLEVTNASLYKGIA-EMKVGNRILNIS 149
gi 2497792    73 NEVVIHGIPT-D-YVLQEGDIIGLDLGVEVDGYYGDSALTLPIGA-ISPQDEKLLACSKESLMHAIN-SIRVGMHFKELS 148
gi 1351928   197 NEVICHGVPD-K-TVLKEGDIVNLDVSLYYQGYHADLNETYYVGEnISKEALNTTETSRECLKLAIK-MCKPGTTFQELG 273
gi 1351927    72 NQTVIHGVAD-Q-TVFKDSDKLTLDIGIDYHGYLCDAAFTLLGNK-ADPKAVKLLNDVEQAFSKVIEpELFVNNPIGNLS 148
gi 489326401  71 NDEVAHGIPStS-KILKAGDLVNIDISAEFGGFYSDTGISFVLGE-GEERLHKLCQCAENAFQKGLQ-QAKAGKRQNQIG 147
gi 6647424    79 NDEVVHGLPKkE-KVIKEGDVVSIDFGAIYDGYAGDSAITVIAGK-GSPEAQKLLEATKEALYNAIE-KALPGKKVGDIT 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P98_A       150 AAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRET----NVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKT 224
gi 113740    151 AAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRET----NVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKT 225
gi 1703276   174 AAIQAYAEASGFSVVRDMVGHGIGRQMHTEL-QIPHYGKRGS----GLKLRPGMVFTVEPMLNEGTYELTFLADGWTVIT 248
gi 3913033   150 KAIEDYIKPFGFGIVREYTGHGVGFELHEEP-SVPNYYAPFFk---NIRIQEGMVLAIEPMVNLRGHKVSIKSDGWTVFA 225
gi 2497792   149 QILESTITERGFVPLKGFCGHGIGKKPHEEP-EIPNYLEKGVkpnsGPKIKEGMVFCLEPMVCQKQGEPKILADKWSVVS 227
gi 1351928   274 DHIEKHATENKCSVVRTYCGHGVGEFFHCSP-NIPHYAKNRT----PGVMKPGMVFTIEPMINEGTWKDMTWPDDWTSTT 348
gi 1351927   149 NAIQTYFENKGYFLVKEFGGHGCGIKIHEDP-LILNWGEKNQ----GVRLQEGMVICIEPMVMTDSSEITMAANNWNVLT 223
gi 489326401 148 RAVYHEARSQGFTVIKTLTGHGIGRSLHEAPnHIMNYYDPFD----NALFKNGTVIALEPFISTKAETIVEAGDGWTFKT 223
gi 6647424   156 KAIHETAEKYGFKTILRYGGHGVGRKVHQEP-FVPNNVKDIGk--kNPRLRQGMVIAIEPMLSIGTEETVEDGDGWTVKT 232
                        250       260
                 ....*....|....*....|....*.
2P98_A       225 KDRSLSAQYEHTIVVTDNGCEILTLR 250
gi 113740    226 KDRSLSAQYEHTIVVTDNGCEILTLR 251
gi 1703276   249 KDKKLSAQFEHTVVVTEEGVEILTLA 274
gi 3913033   226 SDLSYSAHFEHTVAVVDGLPLILSEV 251
gi 2497792   228 VDGLNTSHHEHTIAIVGNKAVILTER 253
gi 1351928   349 QDGKLSAQFEHTLLVTEHGVEILTAR 374
gi 1351927   224 LKSKFNCHVEQMYHITNNGFECLTN- 248
gi 489326401 224 PDKSMVAQVEHTIVITKDEPIILTKL 249
gi 6647424   233 KDGSLAAHFEHTVAITKKGPVILTEL 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap