1HOR,3HN6


Conserved Protein Domain Family
nagB

?
TIGR00502: nagB 
Click on image for an interactive view with Cn3D
glucosamine-6-phosphate isomerase
The set of proteins recognized by this model includes a closely related pair from Bacillus subtilis, one of which is uncharacterized but included as a member of the orthologous set. [Central intermediary metabolism, Amino sugars]
Statistics
?
PSSM-Id: 129593
View PSSM: TIGR00502
Aligned: 7 rows
Threshold Bit Score: 427.307
Threshold Setting Gi: 3122426
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HOR_A       1 MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKE 80
gi 1171641   1 MRFIPLQTEQQVSCWAAQHIINRINDFKPTAERPFVLGLPTGGTPLKTYQELIRLYQAGKVSFKHVVTFNMDEYVALPEE 80
gi 3122423   1 MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEEN 80
gi 3122426   1 MKVMECQTYEELSQIAARITADTIKE-KPD-A---VLGLATGGTPEGTYRQLIRLHQTENLSFQNITTVNLDEYAGLSSD 75
gi 3123105   1 MKILIAEHYEELCKLSAAIIKEQIQA-KKD-A---VLGLATGSTPVGLYKQLISDYQAGEIDFSKVTTFNLDEYAGLSPS 75
gi 127802    1 MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKE 80
3HN6_A      22 MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEEN 101
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HOR_A      81 HPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIK 160
gi 1171641  81 HPESYHSFMYNNFFNHIDILPENINILNGNTDDHNAECRRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLSSRTRIK 160
gi 3122423  81 HPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIK 160
gi 3122426  76 DPNSYHFYMNDRFFQHIDSKPSRHFIPNGNADDLEAECRRYEQLVDSLGDTDIQLLGIGRNGHIGFNEPGTSFKSRTHVV 155
gi 3123105  76 HPQSYNHFMHEHLFQHINMQPDHIHIPQGDNPQLEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVV 155
gi 127802   81 HPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIK 160
3HN6_A     102 HPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIK 181
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HOR_A     161 TLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVC 239
gi 1171641 161 TLTQDTLIANSRFFNNDVTQVPKYALTIGVGTLLD-AEEVMILATGHQKALAVQAAVEGSINHLWTVSALQMHRHFLLVC 239
gi 3122423 161 TLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMD-SQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVS 239
gi 3122426 156 TLNEQTRQANARYFP-SIDSVPKKALTMGIQTILS-SKRILLLISGKSKAEAVRKLLEGNISEDFPASALHLHSDVTVLI 233
gi 3123105 156 KLSESTIQANARFFGGDPVLVPRLAISMGIKTIMEfSKHIVLLASGEEKADAIQKMAEGPVTTDVPASILQKHNHVTVIA 235
gi 127802  161 TLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVC 239
3HN6_A     182 TLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMD-SQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVS 260
                      250       260
               ....*....|....*....|
1HOR_A     240 DEPSTMELKVKTLRYFNELE 259
gi 1171641 240 DEAAQQELKVKTVKYFTELE 259
gi 3122423 240 DKNATYELKVGTVEYFNDIE 259
gi 3122426 234 DREAASLRP----------- 242
gi 3123105 236 DYKAAQKLKSASFS------ 249
gi 127802  240 DEPSTMELKVKTLRYFNELE 259
3HN6_A     261 DKNATYELKVGTVEYFNDIE 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap