Conserved Protein Domain Family
pyro_pdase

?
TIGR00504: pyro_pdase 
pyroglutamyl-peptidase I
Alternate names include pyroglutamate aminopeptidase, pyrrolidone-carboxylate peptidase, and 5-oxoprolyl-peptidase. It removes pyroglutamate (pyrrolidone-carboxylate, a modified glutamine) that can otherwise block hydrolysis of a polypeptide at the amino end, and so can be extremely useful in the biochemical studies of proteins. The biological role in the various species in which it is found is not fully understood. The enzyme appears to be a homodimer. It does not closely resemble any other peptidases. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 129595
View PSSM: TIGR00504
Aligned: 4 rows
Threshold Bit Score: 314.86
Threshold Setting Gi: 6093659
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6093659   3 KVLVTGFGPYGVTPVNPAQLTAEELDGRTIaG-ATVISRIVPNTFFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVER 81
gi 129705    4 KVLITGFDPFDKETVNPSWEAAKRLNGFET-EeAIITAEQIPTVFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPER 82
gi 1172048   3 IVLLTGFEPFDQDPVNPSWEAVRQLDGVQLgSdVKIVARRLPCAFATAGECLTRLIDELHPAMVIATGLGPGRSDISVER 82
gi 6093661   2 KILLTGFEPFGGDDKNPTMDIVEALSERIP----EVVGEILPVSFKRAREKLLKVLDDVRPDITINLGLAPGRTHISVER 77
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6093659  82 LAQNVNDCGrygLADCAGRVLVGEPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKG 161
gi 129705   83 VAINLADAR---IPDNEGHQPIDEEISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTS 159
gi 1172048  83 VAININDAR---IPDNLGEQPIDTAVVADGPAAFFTTLPIKAMVKAVREAGIAASVSQTAGTFVCNQVFYLLQHALAGSG 159
gi 6093661  78 VAVNMIDAR---IPDNDGEQPKDEPIVEGGPAAYFATIPTREIVEEMKKNGIPAVLSYTAGTYLCNFAMYLTLHTSATKG 154
                      170       180       190       200       210       220
               ....*....|....*....|....*....|....*....|....*....|....*....|
gi 6093659 162 LPVRAGWIHLPCLPSVAALDhnlGVPSMSVQTAVAGVTAGIEAAIRQSADIREPIpSRLQ 221
gi 129705  160 PHIRGGFIHIPYIPQQTIDK---TAPSLSLDTIVRALRIAAVTAAQYDEDVKSPG-GTLH 215
gi 1172048 160 --VRSGFIHVPFLPEQVAGS---QRPSMALDAMVAGLQAAVLTAWHTPVDVKEAG-GQVS 213
gi 6093661 155 YPKIAGFIHVPYTPDQVLEKk--NTPSMSLDLEIKGVEIAIRVAQSALHSSQLR------ 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap