2VOE


Conserved Protein Domain Family
alaDH

?
TIGR00518: alaDH 
Click on image for an interactive view with Cn3D
alanine dehydrogenase
The family of known L-alanine dehydrogenases (EC 1.4.1.1) includes representatives from the Proteobacteria, Firmicutes, Cyanobacteria, and Actinobacteria, all with about 50 % identity or better. An outlier to this group in both sequence and gap pattern is the homolog from Helicobacter pylori, an epsilon division Proteobacteria, which must be considered a putative alanine dehydrogenase. In Mycobacterium smegmatis and M. tuberculosis, the enzyme doubles as a glycine dehydrogenase (1.4.1.10), running in the reverse direction (glyoxylate amination to glycine, with conversion of NADH to NAD+). Related proteins include saccharopine dehydrogenase and the N-terminal half of the NAD(P) transhydrogenase alpha subunit. All of these related proteins bind NAD and/or NADP. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 129609
View PSSM: TIGR00518
Aligned: 4 rows
Threshold Bit Score: 605.369
Threshold Setting Gi: 16329382
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VOE_A         1 MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWaD-ADLLLKVKEPIA 79
gi 585047      1 MIIGVPKEIKNNENRVALTPGGVSQLISNGHRVLVETGAGLGSGFENEAYESAGAEIIADPKQVW-D-AEMVMKVKEPLP 78
gi 499173833   1 MEIGVPKEIKDQEFRVGLTPSSVRALLSQGHQVFVEEGAGVGSGFPDGAYAKAGAELVATAKEAW-N-RELVVKVKEPLP 78
gi 6166116     1 MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVW-AdADLLLKVKEPIA 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VOE_A        80 AEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADgALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVL 159
gi 585047     79 EEYVYFRKGLVLFTYLHLAAEPELAQALKDKGVTAIAYETVSEGR-TLPLLTPMSEVAGRMAAQIGAQFLEKPKGGKGIL 157
gi 499173833  79 EEYEYLTLPKLLFTYLHLAAERTLTEALIKSGITAIAYETVELADgQLPLLAPMSRIAGRLAVQMGAHYLEKQQGGRGVL 158
gi 6166116    80 AEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADgALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VOE_A       160 MGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAV 239
gi 585047    158 LAGVPGVSRGKVTIIGGGVVGTNAAKMAVGLGADVTIIDLNADRLRQLDDIFGHQIKTLISNPVNIADAVAEADLLICAV 237
gi 499173833 159 LGGVPGVKAGQVTILGGGVVGTEAAKMAIGLGAMVTILDINVDRLNQLGELFGSRVDLRYSNASQIEDLLPHTDLLIGAV 238
gi 6166116   160 MGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAV 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VOE_A       240 LVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSR-PTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATM 318
gi 585047    238 LIPGAKAPTLVTEEMVKQMKPGSVIVDVAIDQGGIVETVDhITTHDQPTYEKHGVVHYAVANMPGAVPRTSTIALTNVTV 317
gi 499173833 239 LITGKRAPVLVSRQEVEQMLPGAVIMDVAIDQGGCVETLR-VTSHSQPSYIEAEVVHVGIPNMPGATPWTATQALNNSTL 317
gi 6166116   240 LVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSR-PTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATM 318
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
2VOE_A       319 PYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA 371
gi 585047    318 PYALQIANKGAVKALADNTALRAGLNTANGHVTYEAVARDLGYEYVPAEKALQ 370
gi 499173833 318 RYVLKLANLG-EQAWENDLPLAKGVNVQAGKLVQGAVKTVFPDL--------- 360
gi 6166116   319 PYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap