Conserved Protein Domain Family
AGP_acyltrn

?
TIGR00530: AGP_acyltrn 
1-acyl-sn-glycerol-3-phosphate acyltransferases
This model describes the core homologous region of a collection of related proteins, several of which are known to act as 1-acyl-sn-glycerol-3-phosphate acyltransferases (EC 2.3.1.51). Proteins scoring above the trusted cutoff are likely to have the same general activity. However, there is variation among characterized members as to whether the acyl group can be donated by acyl carrier protein or coenzyme A, and in the length and saturation of the donated acyl group. 1-acyl-sn-glycerol-3-phosphate acyltransferase is also called 1-AGP acyltransferase, lysophosphatidic acid acyltransferase, and LPA acyltransferase. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 129621
View PSSM: TIGR00530
Aligned: 10 rows
Threshold Bit Score: 159.049
Threshold Setting Gi: 16078019
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2498789    70 GVKVVIVNPENVP-KKAVLVVANHKSNLDPLILIKAF-GktegvPPLTFIAKIELQDTWLFKIMKLID-CVFIDRKN-LR 145
gi 130327     50 GLKVECRKPTDAEsYGNAIYIANHQNNYDMVTASNIV-Q-----PPTVTVGKKSLLWIPFFGQLYWLTgNLLIDRNNrTK 123
gi 1172534    50 GLKVEHRIPQDQKqISRAIYIGNHQNNYDMVTISYMV-Q-----PRTVSVGKKSLIWIPFFGILYWVTgNIFLDRENrTK 123
gi 464422     60 GLDVKVVGEENLA-KKPYIMIANHQSTLDIFMLGRIF-P-----PGCTVTAKKSLKYVPFLGWFMALSgTYFLDRSKrQE 132
gi 3914373    54 GVNLEKIGTFDTD---AKLIVLNHQSLLDIIYLEAYH-P-----RNICWIAKKELGEIPFYGHALTDTgMILIDRED-KK 123
gi 3914378    65 GIKIIVTGSENIPkKSNVIIMGNHIAAMDPLIFIYTF-A-----CPFVILAKHSLLRIPFVNIVLIVMgVIFVNRRS-IR 137
gi 2498788    70 GIKVVTVNDKIIP-KKPVLVVANHKSNLDPLVLIKAF-GrlknsPPLTFVAKIELKDTVLFKLMKLID-CVFIDRKN-IR 145
gi 972978     58 GLEVGRPAPEH-P--NGVLVAANHVSWLDIFAMSAVY-P-------SSFIAKQEIKSWPVLGKMGQNAgTVFINRNS-RR 125
gi 499175637  41 lFQAQVYGQELVPtRGPALVVSNHASYFDPPFLSCAM-A-----RPVAFMAKEELFNVPLLGPAIRLYgAYPVKRGS--- 111
gi 639651257  16 rggVKVYNKENLPaDSGFVIACTHSGWVDVITLGVGIlP-----YQIHYMAKKELFQNKWIGSFLKKIhAFPVDREN--- 87
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 2498789   146 QMAASLEQQQQIIRQGTALCVFPEGTRVLS--RQIGEFKSGALKVAYNAFVPIVPLTIV 202
gi 130327    124 AHGTIAEVVNHFKKRRISIWMFPEGTRSRG--RGLLPFKTGAFHAAIAAGVPIIPVCVS 180
gi 1172534   124 AHNTMSQLARRINEDNLSIWMFPEGTRNRG--RGLLPFKTGAFHAAISAGVPIIPVVCS 180
gi 464422    133 AIDTLNKGLENVKKNKRALWVFPEGTRSYTseLTMLPFKKGAFHLAQQGKIPIVPVVVS 191
gi 3914373   124 GIVSLLKACKEKLDQNRPLVIFPEGTRGKGg-EKFLPFKQGAKIIAEKFQLKIQPMVLI 181
gi 3914378   138 SAAAAEVKAIKVMREGRSIGIFPEGTRNRG--GDTRVFKKGSIKMALKTGTSILPVTLY 194
gi 2498788   146 QIANALETQQQLIRQGTAIAVFAEGTRILS--NDIGEFKPGALKVAYNAFVPILPVSIV 202
gi 972978    126 DIEPINRAVYETLQRGQNVSFFPEARTSSGlgLWISAFKAALFQSAIDAGAKVLAVALR 184
gi 499175637 112 GDRGALRAALTALGDGWLVGVFLEGTRTKD--GRIHQPKLGAAMIAAKAQVPIIPVSLG 168
gi 639651257  88 PGPSSIKTPIKLLKEGEIVGIFPSGTRTSE--DVPL--KRGAVTIAQMGKAPLVPAAYQ 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap