Conserved Protein Domain Family
HMG_CoA_R_NAD

?
TIGR00532: HMG_CoA_R_NAD 
hydroxymethylglutaryl-CoA reductase, degradative
Most known examples of hydroxymethylglutaryl-CoA reductase are NADP-dependent (EC 1.1.1.34) from eukaryotes and archaea, involved in the biosynthesis of mevalonate from 3-hydroxy-3-methylglutaryl-CoA. This model, in contrast, is built from the two examples in completed genomes of sequences closely related to the degradative, NAD-dependent hydroxymethylglutaryl-CoA reductase of Pseudomonas mevalonii, a bacterium that can use mevalonate as its sole carbon source. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 129623
View PSSM: TIGR00532
Aligned: 2 rows
Threshold Bit Score: 613.578
Threshold Setting Gi: 3929353
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3929353   10 HYKSGKIRRAMSSRIPGfyKLSVEERLKKVAEFAGlsdEEVKAVLSQGLPLDVA-DrMIENVIGTFELPLGIATNFLIDG 88
gi 11132814   1 MNLESLSSFMELSKNFR--HKSVLEKRQEIKSFLE---LSYKDFFYNNANEDFLfN-MIENYIGYLSFPIGIVKNLKING 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3929353   89 KDYLIPMAIEEPSVVAAASNAARMARESGGFTTDYTGSLMIgqiqVTKLLNPNAAKFEVLRQKDEIIERANECDPMLVNL 168
gi 11132814  75 KYYSLPIATEESSVVAALNFAAKILENADLRYSLGEVLGIS----QIYIKSEKDLSKIFVDLGDKIKTWIEPLLTNMNQR 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3929353  169 GGGCKDIEARviDTIMGKMLIVHLIVDVKDAMGANAVNTMCEKVAPFIERITGGKVYLRIISNLAAYR--LARAKAVFDK 246
gi 11132814 151 GGGFRRLSTR--HIKELGIQKLNIYVDTCDAMGANLLNSIAERVAEFIFLEFGYECVLKVLSNDISEFtaKARFVLDFKH 228
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3929353  247 DVIGGEE---VVEGIMLAYAFAAADPFRCATHNKGIMNGISALMIATGNDFRAIEAGAHSYAAIGG-YKPLTTYEvDRKG 322
gi 11132814 229 LLPGKEDswnLAKKIELISSIGFYEEERAVTNNKGIMNGITGVCLATFNDTRALEASVHKFASKSGkYFPLSKFY-TTDN 307
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 3929353  323 NLVGTIEIPMAVGVIGGATKVNPLAKISLKILGVNTAEELARVAAALGLAQNFAALRALATEGIQRGHMELHA 395
gi 11132814 308 ALVGEIEIPLQVGTKGGVISFNEASILSFKIMNVNSKSEFIGILSCVGLASNFAALRALAFNGIQKGHMRLHV 380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap