Conserved Protein Domain Family
HMG_CoA_R_NADP

?
TIGR00533: HMG_CoA_R_NADP 
3-hydroxy-3-methylglutaryl Coenzyme A reductase, hydroxymethylglutaryl-CoA reductase (NADP)
This model represents archaeal examples of the enzyme hydroxymethylglutaryl-CoA reductase (NADP) (EC 1.1.1.34) and the catalytic domain of eukaryotic examples, which also contain a hydrophobic N-terminal domain. This enzyme synthesizes mevalonate, a precursor of isopentenyl pyrophosphate (IPP), a building block for the synthesis of cholesterol, isoprenoids, and other molecules. A related hydroxymethylglutaryl-CoA reductase, typified by an example from Pseudomonas mevalonii, is NAD-dependent and catabolic. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 129624
View PSSM: TIGR00533
Aligned: 4 rows
Threshold Bit Score: 663.108
Threshold Setting Gi: 3929352
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123338   612 MNN-TEVSNLVVNGKLPLYSLEKKLEdTTRAVLVRRKALSTLAEspiLVSEKLPFRNYDYDRVFGACCENVIGYMPIPVG 690
gi 2495267    1 MENyNDILEKMLNGEIKPYQLDKMFG-SKIATEIRRKFIEKKVG---IEFKHICNYSIDEEMAMKKNIENMIGAIQIPLG 76
gi 3929352    1 MS----IMDDLMEGRIKLYEIERHVP-VDEAVRIRREFIERTCG---VKLEHVSNYSIDMERASRRNIENPIGVVQIPLG 72
gi 123336   616 LKN-KEVAALVIHGKLPLYALEKKLGdTTRAVAVRRKALSILAEapvLASDRLPYKNYDYDRVFGACCENVIGYMPLPVG 694
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123338   691 VIGPLIIDG----TSYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTLIRSGACKIWLDseEGQ 766
gi 2495267   77 FAGPLKINGeyakGEFYIPLATTEGALVASVNRGCSIITKCGGATVRVIDDKMTRAPCLKTKSVVDAIKVRDWIR--ENF 154
gi 3929352   73 VAGPLRVRGehadGEYYVPLATSEGALVASVNRGCSVITRAGGATVRVTGDSMTRAPVIRTGSVVEALQLREWIY--ENM 150
gi 123336   695 VIGPLVIDG----TSYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTLKRSGACKIWLDseEGQ 770
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123338   767 NSIKKAFNSTSRFARLQHIQ-TCLAGDLLFMRFRTTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEV--VSVSGNYCTD 843
gi 2495267  155 ERIKEVAESTTRHGKLIKIEpILIVGRNLYPRFVFKTGDAMGMNMVTIATEKACNFIEGELKKEGIFVktVAVSGNACVD 234
gi 3929352  151 DALREEAESTTRHGKLVKIDpIIVAGSYVYPRFVYTTGDSMGMNMVTIATERALELLTRET---GAHV--IALSGNLCTD 225
gi 123336   771 NAIKKAFNSTSRFARLQHIQ-TCLAGDLLFMRFRTTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEV--VSVSGNYCTD 847
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123338   844 KKPAAINWIEGRGKSVVAEATIPGDVVKSVLKSDVSALVELNISKNLVGSAMAGSVGgFNAHAANLVTALFLALGQDPAQ 923
gi 2495267  235 KKPSGMNLINGRGKSIVAEVFLTEKEVNKYLKTTSQAIAEVNRLKNYIGSAISNSMG-FNAHYANIIGAIFLATGQDEAH 313
gi 3929352  226 KKPAAVNLIEGRGKSITAEITVPGEMVESVLKTTPEAVVEVNTAKNLIGSAAAGSMG-FNAHYANIIGAIFLATGQDEAH 304
gi 123336   848 KKPAAINWIEGRGKSVVAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGgFNAHAANLVTAVFLALGQDPAQ 927
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123338   924 NVESSNCITLMK-EVDGdLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGphptepGANARQLARIIACAVLAGELS 1002
gi 2495267  314 IVEGSLGITMAEvEDDG-LYFSVTLPDVPIGTVGGGTRVETQKECLEMLGCYG------DNKALKFAEIVGAAVLAGELS 386
gi 3929352  305 IVEGSLGVTIAE-ERKGdLYFAVNLPDVPLATVGGGTGLETASECLDIMGVRG------GGRVHAFAEIVGGAVLAGELS 377
gi 123336   928 NVESSNCITLMK-EVDGdLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGphatapGTNARQLARIVACAVLAGELS 1006
                       410
                ....*....|....*....
gi 123338  1003 LCSALAAGHLVQSHMTHNR 1021
gi 2495267  387 LLGALAAGHLGKAHQELGR 405
gi 3929352  378 LMGALAAGHLARAHSELGR 396
gi 123336  1007 LCAALAAGHLVQSHMTHNR 1025
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap