Conserved Protein Domain Family
hemK_rel_arch

?
TIGR00537: hemK_rel_arch 
HemK-related putative methylase
The gene hemK from E. coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase. Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity (Medline 99237242). Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. This model represents an archaeal and eukaryotic protein family that lacks an N-terminal domain found in HemK and its eubacterial homologs. It is found in a single copy in the first six completed archaeal and eukaryotic genomes. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 129628
View PSSM: TIGR00537
Aligned: 3 rows
Threshold Bit Score: 228.972
Threshold Setting Gi: 6226464
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3024936    16 VYEPAEDS-ILLLKNLVDVKNKD-VLEIGVGTGLISIACAKKGAkKIVGVDINPYAVKLAKEnaklnnVNISFFESDLFE 93
gi 6226464     2 IYEPAEDSeLLLEAALRELKPDDeVIEVGAGSGFVAERLKGKCK-CILTTDISPFAAMELRR------KGLDVVMTDIAK 74
gi 499179402  17 VYEPAEDT-FLLADNLDVREGDR-VLEIGTGTGLVAIRASEKGD--VTATDVNPAAVKCTQEnaiingVELRVLQGDLFD 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3024936    94 NVTG-KFDVILFNPPYLPTSEDEKIDSYLNFAFDGGKDGREILDRFIYELPNYLKKGGVVQILQSSLTgEKETINKLKPL 172
gi 6226464    75 GIRK-KFSLVLFNPPYVELEDELRRGDWLDVAIDGGKKGVKVIKKFLDSLDEIMAERGRAILIASSQN-EPDVFDLIDER 152
gi 499179402  93 PVEGeKFDVILFNTPYLPATGDDATGDVLDLAWNGGPDGRMVIDRFLDEVPAHLKPGGRVQLVQSSLSdTEKTLQKLADM 172
                        170       180
                 ....*....|....*....|...
gi 3024936   173 GFKVEISARLKVPFEELMVINAW 195
gi 6226464   153 GFRYEIVGERGLFFEKLFAIKIW 175
gi 499179402 173 GFDASVTASERYFFEEIVLITAM 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap