1OLT


Conserved Protein Domain Family
hemN

?
TIGR00538: hemN 
Click on image for an interactive view with Cn3D
oxygen-independent coproporphyrinogen III oxidase
This model represents HemN, the oxygen-independent coproporphyrinogen III oxidase that replaces HemF function under anaerobic conditions. Several species, including E. coli, Helicobacter pylori, and Aquifex aeolicus, have both a member of this family and a member of another, closely related family for which there is no evidence of coproporphyrinogen III oxidase activity. Members of this family have a perfectly conserved motif PYRT[SC]YP in a region N-terminal to the region of homology with the related uncharacterized protein. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 129629
View PSSM: TIGR00538
Aligned: 5 rows
Threshold Bit Score: 806.704
Threshold Setting Gi: 3122198
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OLT_A         6 IDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVAR----YPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHK 81
gi 3913815     3 AEFDKELIKKYDRPGPRYTSYPPATEFTEEVKEDEYVKRLIKs--nERKTPLSLYFHIPFCEQRCLYCGCNVIISHRKGI 80
gi 3122198     2 QTIDFEKFSQYSKPGPRYTSYPTAVEFNENFNEESLKTAFFNhdnlKNPMPLSLYTHLPFCRSACYFCACSVIYTSLEEK 81
gi 487491258   8 IDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVAR----YPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHK 83
gi 3122206     8 VEFSAELLNKYNQGIPRYTSYPPATELNKEFDPSDFQTAINLg--nYKKTPLSLYCHIPFCAKACYFCGCNTIITQHKPA 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OLT_A        82 ADQYLDALEQEIVHRAPLFAG-RHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQ-FNADAEISIEVDPREIELDVLDHL 159
gi 3913815    81 EEPYLERVCREMDLVSQYLDKdRKVIQLHWGGGTPNYLSPEQIKWFMEEIRKRFE-FGDNAEISIELDPRYLTDEQIKAI 159
gi 3122198    82 KIRYISYLKKELALLKNAMDTnREVAQFHYGGGTPTFFSPIQLDEITQSIQEVFPnFSKDIEMSCEIDPRHFTKEHMQTL 161
gi 487491258  84 ADQYLDALEQEIVHRAPLFAG-RHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQ-FNADAEISIEVDPREIELDVLDHL 161
gi 3122206    86 VDPYLKAVAKQIALVAPLVDQqRPVQQLHWGGGTPNYLTLEQAEFLFNTITDAFP-LAENAEISIEINPCYVDKDYIFAL 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OLT_A       160 RAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSV 239
gi 3913815   160 KDAGFNRISLGVQDLDPKVQQAVNRVQPYELIKEKMEKLREAGFESINLDLIYGLPYQTKESFEKTVEKVIELNPDRIAT 239
gi 3122198   162 FDRGFNRLSFGVQDFDFEVQKAIHRIQPFEMVQESVKLARDYGIKSINFDLIYGLPNQTKEGFLKTLEWVLKLDPDRLAV 241
gi 487491258 162 RAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSV 241
gi 3122206   165 RQLGFNRISFGIQDFNSQVQQAVNRIQPEAMLFQVMDWIRQANFDSVNVDLIYGLPHQNLATFRETLRKTAQLNPDRIAV 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OLT_A       240 FNYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDT 319
gi 3913815   240 YSFAYIPQVKPHQQLLPKEALPSAEEKLRIFEMVINKFQEAGYVYIGMDHFAKPEDELAVAQRKGELWRNFQGYTTKKGV 319
gi 3122198   242 FNYAHVPWVKKTMRKIDETLLPSLRDKLEILESLISFLEKANYQMIGMDHFAKSDNELYLALQKAELRRNFQGYTTKKFT 321
gi 487491258 242 FNYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDT 321
gi 3122206   245 FNFAYVPWLKPVQKKMPESALPPAEEKLKIMQATIADLTEQGYVFIGMDHFAKPDDELAIAQRRGELHRNFQGYTTQPES 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OLT_A       320 DLLGMGVSAISMIGDCYAQNQKELKQYYQQVDEQGNALWRGIALTRDDCIRRDVIKSLICNFRLDYSPIEQQWDL----L 395
gi 3913815   320 ELLGFGATSIGMLYDSYFQNWKTLRDYNKTVDEGKIPVFRGYVLNEDDFIRREVIMDIMCNLGVEFSKIENMFGI----N 395
gi 3122198   322 QTIGIGVTSIGEGGDYYTQNYKDLHHYEKALDLGHLPVERGVALSQEDVLRKEVIMQMMSNLKLDYSKIEEKFSV----D 397
gi 487491258 322 DLLGMGVSAISMIGDCYAQNQKELKQYYQQVDEQGNALWRGIALTRDDCIRRDVIKSLICNFRLDYAPIEKQWDL----H 397
gi 3122206   325 DLLGFGITSISMLQDVYAQNHKTLKAFYNALDREVMPIEKGFKLSQDDLIRRTVIKELMCQFKLSAQELESKYNLgfdcD 404
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
1OLT_A       396 FADYFAEDLKLLAPLAKDGLVDVDEKGIQVTAKGRLLIRNICMCFDTYLRQKaRMQQFSRVI 457
gi 3913815   396 FREYFAKELEELKEMEEDGLIKVEEDRIKIMPVGRLLIRNVAMVFDAHLRRK-KELNFSRTI 456
gi 3122198   398 FKAHFKKELEKLKPYEEAGLLSFNSKGFEMTKTGGMLVRNMAMEFDAYLRGG--EKHFSKTL 457
gi 487491258 398 FADYFAEDLKLLAPLAKDGLVDVDEKGIQVTAKGRLLIRNICMCFDTYLRQKaRMQQFSRVI 459
gi 3122206   405 FNDYFAKELSALDVLEADGLLRRLGDGLEVTPRGRILIRNIAAVFDTYLQNKsKQQMFSRAI 466
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap