Conserved Protein Domain Family
hisDCase_pyru

?
TIGR00541: hisDCase_pyru 
histidine decarboxylase, pyruvoyl type
This enzyme converts histadine to histamine in a single step by catalyzing the release of CO2. This type is synthesized as an inactive single chain precursor, then cleaved into two chains. The Ser at the new N-terminus at the cleavage site is converted to a pyruvoyl group essential for activity. This type of histidine decarboxylase appears is known so far only in some Gram-positive bacteria, where it may play a role in amino acid catabolism. There is also a pyridoxal phosphate type histidine decarboxylase, as found in human, where histamine is a biologically active amine. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 129632
View PSSM: TIGR00541
Aligned: 2 rows
Threshold Bit Score: 610.865
Threshold Setting Gi: 124077297
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124077297   3 ELDAKLNKLGVDRIAISPYKQWTRGYMEPGNIGNGYVTGLKVDAGVRDKSDDDVLDGIVSYDRAETKNAYIGQINMTTAS 82
gi 144834     18 HKNIKVRAPKIDKTAISPYDRYCDGYGMPGAYGNGYVSVLKVSVGTVKKTDDILLDGIVSYDRAEINDAYVGQINMLTAS 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124077297  83 SFTGVQGRVIGYDILR--SPEVDKAKPLFTETQWDGSELPIYDAKPLQDALVEYFGTEQDRRHYPAPGSFIVCANKGVTA 160
gi 144834     98 SFCGVAGQVWGHDLAThdSIANDEIKPLYELKQFDGTPLKVYDAKPLLEAGIELFGTEKNRRFTTAPGAHVICANKSATA 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124077297 161 ERPKNDADMKPGQGYGVWSAIAISFAKDPTKDSSMFVEDAGVWETP-NEDELLEYLEGRRKAMAKSIAECGQDAHASFES 239
gi 144834    178 YRPKENRPLKEGEAYGVWSFIALSLSNDRDHCADLFIEDAGLWTKNdNPEDLKKFLEDHRKAVTWSVVECGRDSHVVFER 257
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124077297 240 SWIGFAYTMMEPGQIGNAITVAPYVSLPIDSIPGgsiltpdKDMEIMENLTMPEWLEKMGYKSLSANNAL 309
gi 144834    258 TYIGFAYVIMKPGEIGNALTCAPYVTLARDAVPS-------EGFPSLNRISLSQWLDDMNFDSLVNPSKK 320
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap