Conserved Protein Domain Family
lolA

?
TIGR00547: lolA 
periplasmic chaperone LolA
This protein, LolA, is known so far only in the gamma and beta subdivisions of the Proteobacteria. The E. coli major outer lipoprotein (Lpp) of E. coli is released from the inner membrane as a complex with this chaperone in an energy-requiring process, and is then delivered to LolB for insertion into the outer membrane. LolA is involved in the delivery of lipoproteins generally, rather than just Lpp, and is an essential protein in E. coli, unlike Lpp itself. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 129638
View PSSM: TIGR00547
Aligned: 2 rows
Threshold Bit Score: 370.92
Threshold Setting Gi: 1170807
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170807     1 MKKTTLKFAALTLLgLSNLALADAASELQMRLAKVDVLSAEFVQTVTSGSGKNVQQGSGKLQIKRPNLFRMETKTPQETQ 80
gi 446898791   2 MKKIAITCALLSSL-VASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170807    81 IISDGKTLWFYDPFVQQVTAQWVKNAVNNTPFVLLTSNDKSHWHQYTVTQQSDTFVLKPTLSTSNIKQFDIRVDANGILR 160
gi 446898791  81 LVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIH 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 1170807   161 NFSTTEKDGQTNLYVLRNITNQTLSDSLFQFKPEKGVEVDDQRK 204
gi 446898791 161 QFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap