Conserved Protein Domain Family
lolB

?
TIGR00548: lolB 
outer membrane lipoprotein LolB
This protein, LolB, is known so far only in the gamma and beta subdivisions of the Proteobacteria. It is a processed, lipid-modified outer membrane protein. It is required in E. coli for insertion of the major outer lipoprotein (Lpp) into the outer membrane. Lpp is transferred to LolB from the carrier protein LolA in the periplasm. Previously, this protein was thought to play in role in 5-aminolevulinic acid synthesis and was designated HemM. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 129639
View PSSM: TIGR00548
Aligned: 3 rows
Threshold Bit Score: 281.091
Threshold Setting Gi: 557258
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507042   5 DFRLIRLLpLAALVLTACSVTTPKGPGKS---PDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRY 81
gi 1170232   6 TFKFFTAL-FATAILTACTLDMERPTNVQyidKTDAIWQQHLQKIQKIQSYQAKGQIGYISPTERFSSRFEWQYQNPKSY 84
gi 557258    2 RLRLFLAA-SALALLSGCAGLTSHEALEGq--GDAQTWKTHKQQLSELDAWQIDGKVGIRAPRDSGSGTLFWLQR-QGYY 77
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2507042  82 RLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEIT 161
gi 1170232  85 TLKLYSLISKSTLWIQMHQSGMTISDNNGNQQSAANSKLLLQEIIGMDVPLEHLAYWLKGQPAMNADYQVGTNHLLGAFT 164
gi 557258   78 DIRLSGPLGRGAARLTGREGAVSLEVAGQGRYQAESPESTAGRTLGWRLPVSHLLWWVRGLPAPDSKSRLTLDADSRLAR 157
                      170       180       190       200
               ....*....|....*....|....*....|....*....|....*..
gi 2507042 162 YSQNGKNWKVVYGGYDTKTQpaMPANMELTD--GGQRIKLKMDNWIV 206
gi 1170232 165 YHVDGSQWTADYLTYHSNNS--MPENILLKNdsTKQTLKIRVDEWIY 209
gi 557258  158 LEQDG--WQIEYTRYAEQNGywLPERLKLHG--QDLDVTLVIKDWQP 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap