2FD8


Conserved Protein Domain Family
alkb

?
TIGR00568: alkb 
Click on image for an interactive view with Cn3D
DNA alkylation damage repair protein AlkB
Proteins in this family have an as of yet undetermined function in the repair of alkylation damage to DNA. Alignment and family designation based on phylogenomic analysis of Jonathan A. Eisen (PhD Thesis, Stanford University, 1999). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129659
View PSSM: TIGR00568
Aligned: 5 rows
Threshold Bit Score: 268.635
Threshold Setting Gi: 2055386
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FD8_A      11 ILRRFAFNAAEQLIRDINDVASQSP-------------------FRQMVTPGGy----------TMSVAMTNCGHLGWTT 61
gi 113638   21 ILRRFAFNAAEQLIRDINDVASQSP-------------------FRQMVTPGGy----------TMSVAMTNCGHLGWTT 71
gi 2055386   1 MARPAGYSAQRALVEAVLAGAEQAP-------------------FSNYRTAYGk----------PMSVAMTALGSLGWTS 51
gi 1237210  44 LKLYSQKPNVCNLDTHMSKEETQDL-------------------WEQSKEFLRyk-------eaTKRRPRSLLEKLRWVT 97
gi 3080529  60 LKNYVSSELQMQLLKSIMFTQIQDPenktnlspfyqlplgndsiWRRYYNGDGesiidglgetkPLTVDRLVHKKLRWVT 139
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FD8_A      62 HRQGYLYSPIDPQTNKPWPAMPQSFHNLCQ-RAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGL 140
gi 113638   72 HRQGYLYSPIDPQTNKPWPAMPQSFHNLCQ-RAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGL 150
gi 2055386  52 DARGYRYVDRHPETGRPWPDMPPALLDL-----WTVLGDPETPPDSCLVNLYATGARMGLHQDRDEADPRFPLLSISLGD 126
gi 1237210  98 VGYHYNWDSKKYSADHYTP-FPSDLGFLSe-QVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQ 175
gi 3080529 140 LGEQYDWTTKEYPDPSKSPGFPKDLGDFVEkVVKESTDFLHWKAEAAIVNFYSPGDTLSAHIDESEEDLTLPLISLSMGL 219
                      170       180       190
               ....*....|....*....|....*....|....*....
2FD8_A     141 PAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGI 179
gi 113638  151 PAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGI 189
gi 2055386 127 TAVFRIGGVNRKDPTRSLRLASGDVCRLLGPARLAFHGV 165
gi 1237210 176 SAIFLLGGLQRDEAPPPMFMHSGDIMIMSGFSRLLNHAV 214
gi 3080529 220 DCIYLIGTESRSEKPSALRLHSGDVVIMTGTSRKAFHGK 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap