1KXU


Conserved Protein Domain Family
ccl1

?
TIGR00569: ccl1 
Click on image for an interactive view with Cn3D
cyclin ccl1
All proteins in this family for which functions are known are cyclins that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, StanfordUniversity). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129660
View PSSM: TIGR00569
Aligned: 6 rows
Threshold Bit Score: 385.727
Threshold Setting Gi: 543985
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KXU_A      12 YHNSSQKRHWTFSsEEQLARLRADANR-----------KFRCKA---VANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEF 77
gi 1706232   2 YHNSSQKRHWTFSsEEQLARLRADANR-----------KFRCKA---VANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEF 67
gi 1706234   2 YHNSTQKKHWTFLsEDEPLRRRIQANV-----------RYRARI---RATEKPRLSEIFSLEPHEELAICKYYEKRLLDF 67
gi 3329502   2 YPVSSQKRSWTFAnEGQLMEFRVEQNS-----------KYIESH---EEEAQGRDLNEHFLTSAEERLLLKQYEIYLFDF 67
gi 543985    6 FRDSTHYRDWIFT-EEDLSKTRAKVNEkftn----ivrERMLEElslQNKEASLEVLPPTLTVEEELELVNYYSFQLNAL 80
gi 584903   49 YRHSSQYRMWSYT-KDQLQEKRVDTNAraiayieenllKFREAHnltEEEIKVLEAKAIPLTMEEELDLVNFYAKKVQVI 127
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KXU_A      78 CSVFKpaMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESplgqekAlEQILEYE 157
gi 1706232  68 CSVFKpaMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESplgqekAlEQILEYE 147
gi 1706234  68 CNAFKptMPKSVLGTACMYFKRFYLNNSVMEHHPRIIMLTCVFLACKVDEFNVSSIQFVGNLGENplgqekIlEQILEYE 147
gi 3329502  68 CRRFEptMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIKGDrn---kAtDIVLSNE 144
gi 543985   81 SSALS--LPTHIRSTAILFFKRFYLINSVMEYSPKIISFTSLFLATKCNDHYISIEQFCKNMPKT------TpEEVLEYE 152
gi 584903  128 AQHLN--LPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISVDSFAQKAKST------R-DSVLKFE 198
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KXU_A     158 LLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTAD---DFLNRIALTDAYLLYTPSQIALTAILSSASRA 234
gi 1706232 148 LLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTAD---DFLNRIALTDAYLLYTPSQIALTAILSSASRA 224
gi 1706234 148 LLLIQQLNFHLIVHNPYRPFEGFLIDVKTRYPMLENPEVLRKSAD---EFLNRVALTDACLLFAPSVIALTAILSTASRA 224
gi 3329502 145 LLLIGQLNYYLTIHNPFRPIEGFLIDIKTRS-NMQNPDRLRPHID---SFIDSTYYSDACLLHTPSQIALAAVLHAASRE 220
gi 543985  153 FNVCQSLKWDLYVWLPFRPLQGFLLDCQTVLPKVAVEKFYECHDLs-kKFLIETLHSDIYFLHSPSIIALGAIYHTNPTI 231
gi 584903  199 FKLLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQIYDrckKRITAALLTDVVYFYTPPQITLATLLIEDEAL 278
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KXU_A     235 GI-----TMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALN-------VITK 302
gi 1706232 225 GI-----TMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALN-------VITK 292
gi 1706234 225 GL-----NMESYLTECLSLKDNQETMSHLLDGMRRLKILVSKYEPARPEEVAALKKRLDHCHSTEVTLS-------VHGR 292
gi 3329502 221 QE-----NLDSYVTDLLFVS-AREKLPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDse----lYKER 290
gi 543985  232 CL---------QYIEAKKIP---ELQPLIISISANLKATKKFKIEK--KKAQDYGRKLYFCMNPLRNKSs------ALYL 291
gi 584903  279 VTryletKFPSREGSQESVPGNEKEEPQNDASTTEKNKEKSTESEEYSIDSAKLLTIIRECKSIIEDCKppsteeaKKIA 358
                      330
               ....*....|....*...
1KXU_A     303 KRKGYED--DDYVSKKSK 318
gi 1706232 293 KRKGYED--DDYVSKKSK 308
gi 1706234 293 KRKGYED--DGYISKKPK 308
gi 3329502 291 LRRLYTDe-DDMPAEDAS 307
gi 543985  292 KRKAEEE--STNNNKWAK 307
gi 584903  359 AKNYYCQnpSTLIQKLKR 376
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap