Conserved Protein Domain Family
dnaq

?
TIGR00573: dnaq 
exonuclease, DNA polymerase III, epsilon subunit family
All proteins in this family for which functions are known are components of the DNA polymerase III complex (epsilon subunit). There is, however, an outgroup that includes paralogs in some gamma-proteobacteria and the n-terminal region of DinG from some low GC gram positive bacteria. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, Degradation of DNA]
Statistics
?
PSSM-Id: 129663
View PSSM: TIGR00573
Aligned: 6 rows
Threshold Bit Score: 238.504
Threshold Setting Gi: 11498577
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118793     413 HRLLEEETYVVFDVETTGLSAVYD-TIIELAAVKVKGGEIIDKFEAFANPHRPLSATIIELTGITDDMLQDAPDVVDVIR 491
gi 118805       6 TRQIVLDTETTGMNQIGAHYEGHK-IIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVAD 84
gi 1169396      5 NRQIVLDTETTGMNQLGAHYEGHC-IIEIGAVELINRRYTGNNXHIYIKPDRPXDPDAIKVHGITDEMLADKPEFKEVAQ 83
gi 2833216      5 QRIIVLDTETTGMNSVGPPYLNHR-IIEIGAIEIINRRFTGKKFHTYIKPNRLIESDASKIHGITDDFLSDKPSFKDIAK 83
gi 6014996      7 FAVHEHVAFTAFDTETTGLKAEEDrIIEIGAVT-FDRKGIIARFSTLIFPDRAIPPDVSKINHITDDMLVNKPRFCEIVS 85
gi 499180932    2 EGSLRKVQFLSIDLETTGLNQKKDeIIAIGAVPIIGTRILAGESYYRLLRPEKFKHESMKFHGLDPARLKTAHDFSEIAE 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118793     492 DFREWIGDDILVAHNASFDMGFLNVAYKKL-LEVEKAKNPVIDTLELGRFLYPEFKNHRLNTLCKKFDIELTQHHRAIYD 570
gi 118805      85 EFMDYIRGAELVIHNAAFDIGFMDYEFSLL-KRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG 163
gi 1169396     84 DFLDYINGAELLIHNAPFDVGFMDYEFRKL-NLN-VKTDDICLVTDTLQMARQMYPGKRNNLDALCDRLGIDNSKRTLHG 161
gi 2833216     84 DFFNYIKNSELIIHNASFDVGFINQEFSML-TKKIQDISNFCNIIDTLKIARKLFPGKKNTLDALCMRYKIKNSHRVLHG 162
gi 6014996     86 DFSRFIKGTVLVAHNANFDVEFLNAELS-L-CKKQPLSHKVVDTYAMAQAVFPGLGRHQYRLQNLALQFGLTVH--AAHR 161
gi 499180932   82 EVADLLRGKVLVGYAIELDYGFLKRALKREgYKVENKRIDVIDFEKAVCYILGERPVGEMTLDNLAKKYRVEVS--YRHN 159
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 118793     571 TEATAYLLLKMLKDAAEKGIQYHdelnENMGqsnayQRSRPYHATLLAVNSTGLKNLFKLVSLSHIHY 638
gi 118805     164 ALLDAQILAEVYLAMTGGQTSMAf---AMEGe---tQQQQGEATIQRIVRQASKLRVVFATDEEIAAH 225
gi 1169396    162 ALLDAEILADVYLMMTGGQTNLFdeeeSVESgvirvMQEKTAEEIKSAVDFSHNLKLLQPTNDELQAH 229
gi 2833216    163 AILDAFLLGKLYLLMTSGQESIIf--nKNIQ-----NERNFRYIKKSITKKHRFLKIIKANKTELKLH 223
gi 6014996    162 AEDDARVCMELFTTMIAHHAKQN-------G-------HCVNHAQSPTIKK--LIQEIQASSTDCSQE 213
gi 499180932  160 ALADAFITAQIFQVQLLKILKYG------------------------IKTIDMLFDLIKRVERDRQYH 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap