Conserved Protein Domain Family
phr2

?
TIGR00591: phr2 
photolyase PhrII
All proteins in this family for which functions are known are DNA-photolyases used for the direct repair of UV irradiation induced DNA damage. Some repair 6-4 photoproducts while others repair cyclobutane pyrimidine dimers. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129679
View PSSM: TIGR00591
Aligned: 7 rows
Threshold Bit Score: 471.193
Threshold Setting Gi: 1197525
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1617219   5 VSVQPGRIRILKKgSWQPSDQTVGPVVYWMFRDQRLKDNWALIHAVDLANRTNAPVAVVFNL-FDQFLDAKARQLGFMLK 83
gi 1401030 178 FSFRKKRVRVLSK-TEDVKESSLGGVVYWMSRDGRVQDNWALLFAQRLALKLELPLTVVFCL-VPKFLNATIRHYKFMMG 255
gi 682750   14 FRFNKQRVRLISQ-DCHLQDHSQA-FVYWMSRDQRVQDNWAFLYAQRLALKQKLPLHVCFCL-APCFLGATIRHYDFMLR 90
gi 1401038  49 MKFSKKRQRFISE-TQKVRQGSGG-VLYWMLRDQRVQDNWALIRAQQLAAKESLPLHVCFCLvVPKSELSTLRHYSFLLK 126
gi 464378   87 CEVNKKRLRYLSD-TQKIKQGSDG-FLYWMSRDQRVQDNWALIYAQQLALAEKLPLHICFCL-VPRYLDATYRQYAFMLK 163
gi 2507184   1 MIHAERIRNLNGE--E-PDLRGSYVVYWMQASVRSHWNHALEYAIETANSLKKPLIVVFGLT-DDFPNANSRHYRFLIEG 76
gi 1197525     --------------------------------------------------------------------------------
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1617219  84 GLRQLHHQIDSLQIPFFLLQG-DAKETIPNFLTE-CGASHLVTDFSPLREIRRCKDEVVKRTSDSLAIHEVDAHNVVPMW 161
gi 1401030 256 GLQEVEQQCRALDIPFHLLMG-SAVEKLPQFVKS-KDIGAVVCDFAPLRLPRQWVEDVGKALPKSVPLVQVDAHNVVPLW 333
gi 682750   91 GLEEVAEECEKLHIPFHLLLG-LPKDVLPAFVQA-HSIGGIVTDFSPLLHHTQWVKDVQDGLPKQVPFVQVDAHNIVPCW 168
gi 1401038 127 GLEEVQKECKHLNIQFHLLHG-AAGDVLPGFVTG-HNFGAVVTDFSPLREPLQWLEAVKKGLPEDIPFIQVDAHNIVPCW 204
gi 464378  164 GLQEVAKECKSLDIQFHLLSG-EPGQNLPSFVEK-WKFGAVVTDFNPLRIPLQWIETVKKHLPADVPFIQVDAHNVVPCW 241
gi 2507184  77 LRDVRSNLRERGIQLVVERDS-PPSVLLKYADD---AAAAVTDRGYLDIQKEWVDEAAGALH--IPLTQVESNVIVPVET 150
gi 1197525   1 --MDMATGCAARGLPYWLELPrTSKEHRPRLAQLgRRAAAIVSDLFPTYIIPGHLRGAAKAL--DVPLFAVDASCVVPMQ 76
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1617219 162 AASSKLEYSARTIRGKINKLLPDYLI-EFPKLEPPKKk-----wTGMMDKKLVDWDSLIDKVVREgAEVPEIEWCVPGED 235
gi 1401030 334 VASDKQEYAARTIRNKINSKLGEYLS-EFPPVVRHPHg------TGCKNVNTVDWSAAYASLQCD-MEVDEVQWAKPGYK 405
gi 682750  169 IASDKQEYGARTIRHKIHDRLPHFLT-EFPPVICHPY-------PSNIQAEPVDWNACRAGLQVD-RSVKEVSWAKPGTA 239
gi 1401038 205 VASPKLEYSARTIRGKITNLLSEFLT-DFPLVDKHPF-------SATKTAKAVDWDKTLASLKVD-RTVGEPKLAKPGTE 275
gi 464378  242 EASGKLEYGARTIRGKITKLLPEFLT-EIPLVDTHPH-------SASRAAEPVDWEEVLSSLEVE-RSVGEVDWAQPGTS 312
gi 2507184 151 ASDKEEYSAGTFKPKIKRHLKRFMVP-LRMRTLKMDS--------LDLEPGPEFEDAVRDFRAPE--DLEPSVFRGGTST 219
gi 1197525  77 RIATR-QIGAYTLRPKLKKLWPEYLDrAVPNRAVKAAaagrklePDFATSDARESRESLDAFDFD-HSVAPIQE-RGGRK 153
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1617219 236 AGIEVLMGnkdgFLTKRLKNYSTDRNNPIKpKALSGLSPYLHFGQVSAQRCALEARKVRSTSPQAVDIFLEELIVRRELS 315
gi 1401030 406 AACQQLYE----FCSRRLRHFNDKRNDPTA-DALSGLSPWLHFGHISAQRCALEVQRFRGQHKASADAFCEEAIVRRELA 480
gi 682750  240 SGLTMLQS----FISQRLPYFGSDRNNPNK-DALSNLSPWFHFGQVSVQRAILEVQKHRSRYPDSVANFVEEAVVRRELA 314
gi 1401038 276 AGLAMLES----FIDVRLKLFGTQRNDPNA-AALSQLSPWLRFGQLSAQRVALQVR---KNSSPSVPAFIEELVVRRELT 347
gi 464378  313 GGMNMLES----FIDQRLRLFATHRNNPNY-DALSHLSPWIHTGQLSAQRVVKQVKRE-KNASESVASFIEELVVRRELA 386
gi 2507184 220 ALSIFSEF----LREKLECFERYRNDPVKN-CLSNMSPYLHFGQISPLYLALRASE-----AGECPEFLEELIVRRELSM 289
gi 1197525 154 AGLDALQA----FVHQRLEGYDEGRNDPGL-ARQSNLSPFFHWGNLFAGEAARAAIRARGAQDASVQGFLEELLVRRELG 228
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1617219 316 DNFCYYQ--PHYDSLKGAWEWARKSLMDHASDKREHIYSLEQLEKGLTADPLWNASQLEMLYQGKMHGFMRMYWAKKILE 393
gi 1401030 481 DNFCFYN--EHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSLTYDDLWNSAQLQLVREGKMHGFLRMYWAKKILE 558
gi 682750  315 DNFCFYN--KNYDKLEGAYDWAQTTLRLHAKDKRPHLYSLEQLESGKTHDPLWNAAQMQMVQEGKMHGFLRMYWAKKILE 392
gi 1401038 348 DNFCFYN--KNYDSVTGAYEWAQKTLKDHAKDKREYLYTREQFEKAQTHDKLWNAAQIQMVTEGKMHGFLRMYWAKKILE 425
gi 464378  387 DNFCFYN--PSYDNISGAYDWAKKTLQDHAKDSRQYLYTKEQLENAKTHDQLWNAAQRQLVSEGKMHGFLRMYWAKKILE 464
gi 2507184 290 NFVHYSD--SYSSISCLPEWAQRTLMDHVADPREYEYSLRELESASTHDPYWNAAQQEMVITGKMHGYMRMYWGKKILEW 367
gi 1197525 229 FNYCFHTpgPQQLSVASLPPWAKETLTRHQKDAREHRYSLKQLETARTADGLWNAAQRELVERGRIHNYLRMLWGKKILE 308
                      410       420       430       440       450       460       470
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1617219 394 WTKGPEEALSISIYLNNKYEIDGRDPSGYVGCMWSICGVHDQGWKERPVFGKIRYMNYAGCKRKFNVDSYISYV 467
gi 1401030 559 WTATPEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGGVHDMGWKERAIFGKVRYMNYQGCRRKFDVNAFVMRY 632
gi 682750  393 WTRSPEEALEFAIYLNDRFQLDGRDPNGYVGCMWSICGIHDQGWAEREIFGKIRYMNYAGCKRKFDVAEFERKY 466
gi 1401038 426 WSTSPEEALSIALYLNDRYELDGQDPNGFVGCMWSICGIHDQGWAERAVFGKIRFMNYKGCLRKFNVAQFERKY 499
gi 464378  465 WTASPEEALSIAIYLNDRLSLDGCDPNGYVGCMWSICGIHDQGWAERPIFGKIRFMNYAGCKRKFDVAQFERKY 538
gi 2507184 368 TDHPARAYDIALYLNDRYEIDGRDPNGFAGVAWCFG-KHDRAWAEREIFGKVRYMNDRGLKRKFRIDEYVDRIR 440
gi 1197525 309 WTPSPQEALQRIAFLNDKYAVDGRDPASVANFMWVL-GLHDRPFQERQVLGKVRPMSSLRTAARYNLAPYLERW 381
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap