Conserved Protein Domain Family
rad24

?
TIGR00602: rad24 
checkpoint protein rad24
All proteins in this family for which functions are known are involved in DNA damage tolerance (likely cell cycle checkpoints).This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129690
View PSSM: TIGR00602
Aligned: 4 rows
Threshold Bit Score: 809.954
Threshold Setting Gi: 1709996
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3410696   2 NQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLessrFPARKRGNLSsLEQIYGLENSKEYLSENEPWV 81
gi 3758878  13 TKVEDWVAPAFDDFEANTAITTITASSLTFSNSSHRRKYLPSTLesnrLSARKRGRLS-LEQTHGLETSRERLSDNEPWV 91
gi 1709996   1 MRRQLSFHESTKRSLKKKKIRKIEKPSLVSKTS--RDKNASITD----IHEEDIEAFS-DEENKIVHLNNLKEDRFQLWF 73
gi 418428    1 MDSTNLNKRPLLQYSLSSLGSQITKWSSSRPTSPVRKARSTEND-----------FLS--KQDTSSILPSINDDGGEQWY 67
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3410696  82 DKYKPETQHELAVHKKKIEEVETWLKAQVLERQPKQggsILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKD 161
gi 3758878  92 DKYKPETQHELAVHKKKIEEVETWLKAQVLEVKPKQggsVLLITGPPGCGKTTTIKILSKELGIQVQEWVNPILPDFQKD 171
gi 1709996  74 EKYIPQKAADLAVHKSKISAIKQWMLTDSLES---R---LLLICGPSGCGKSTAVQVLAKELGYSLIEWLNPMNLKEPSN 147
gi 418428   68 EKFKPNCLEQVAIHKRKLKDVQEALDAMFLPNAKHR---ILLLSGPSGCSKSTVIKELSKILVPKYRQNSNGTSFRSTPN 144
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3410696 162 DFKGMFNTESSFHMFpyQSQIAVFKEFLLRATkyNKLQMLGDDLRTDKKIILVEDLP--NQFYRDSH--TLHEVLR-KYV 236
gi 3758878 172 DYKELLSLESNFSVVpyQSQIAVFNDFLLRATkySKLQMLGDDLTTDKKIILVEELP--NQFYRDPN--ALHEILR-KHV 246
gi 1709996 148 QESDTLSLTEKFSRF--MSLCETYPELELMDS--NNIQKRGKNAQGKKKFIFLDEIPhlSKFNGSLD--AFRNVIRtALT 221
gi 418428  145 EHKVTEFRGDCIVND--LPQMESFSEFLKGAR------YL---VMSNLSLILIEDLP--NVFHIDTRrrFQQLILQwLYS 211
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3410696 237 RIGRCP-LIFIISDS----LSGDNNQ-----RLLFP------KEIQEECSISNISFNPVAPTIMMKFLNRIVTIEANKNG 300
gi 3758878 247 QIGRCP-LVFIVSDS----VSGDNNQ-----RLLFP------RNIQEECSVSNISFNPVAPTIMMKFLNRIVTIEASKNG 310
gi 1709996 222 SRGAFS-IIMVLTEIqlnnLEGINSQd----RNSFNsvqimgNDLLQDPRVTVLQFNPIAPTYMKKCLGSILRKEGVPKS 296
gi 418428  212 SEPLLPpLVICITECei--pENDNNYrkfgiDYTFSaetimnKEILMHPRLKRIKFNPINSTLLKKHLKFICVQNMKMLK 289
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3410696 301 GKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGenNLRPRKKGMSLKSDAVLSKSKRRKKPDRVFENQEVQAIGGKD 380
gi 3758878 311 EKIIVPNKTSLELLCQGCSGDIRSAINSLQFSSSKGenSSWSKKKRMSLKSDAAISKSKQKKKHNSTLENQEIQAIGGKD 390
gi 1709996 297 PKLLS----LVENICSASEGDLRSAINSLQLSISQS-------FEKKGTKNIREVKEGKGKGNDFSLEAAQVLERLSKSD 365
gi 418428  290 EKNKWNKRQEVIDYIAQETGDIRSAITTLQFWATSS--GSLPISTRESTISYFHAIGKVIHGSHSTNNDNEMINNLFENS 367
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3410696 381 VSLFLFRALGKILYCKRASLTELDS--PRLPSHLSEYERDTLLVEPEEVVEMSHMPGD-LFNLYLHQNYIDFFMEIDDIV 457
gi 3758878 391 VSLFLFRALGKILYCKRAPLTELDS--PRLPAHLSEHDRDTLLVQPEEIVEMSHMPGD-FFNLYLHQNYIDFFAEVDDLV 467
gi 1709996 366 SEAYARFKNYKSAYIPKSDKNEN--------SFFKKDVGLGMMHAIGKVVWNKREGDDeVLKASSQQTGNSERIKGVKVS 437
gi 418428  368 NNLLSKEDFKLGILENYNTFNKGEFsiSDASSIVDCLSECDNMNGLPESNEYGLREVRkTFRNISKQGHNHGTVYFPREW 447
                      490       500       510       520       530       540       550       560
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3410696 458 RASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSN-KARGYAHCQGGgSSFRPLHKPQWFLINKKYRENCLAAKALF 536
gi 3758878 468 PASEFLSFADILGGDWNTRSLLREYSTSVATRGVMHSN-KARGFAHCQGG-SSFRPLHKPQWFLIQKKYRENCLAAKALF 545
gi 1709996 438 KSQENKNCISLKS-DQRERMLNVDQCFTSKRRSLVDIE-STINQSGLSGS--VFR------YGLF-ENYVDSCVTTDEAF 506
gi 418428  448 KVRKLQNSFKVQAEDWLNVSLYKYNAVHSFRNITLEFGyYAPLIRKCQSYkKKYILYYLKNLPSGSSGPKQTMDKFSDIM 527
                      570       580       590       600       610       620       630       640
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3410696 537 --PDFCLPALCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGgHSA 614
gi 3758878 546 --VDFCLPALCLQTQLLPYLALLTIPMRNKAQISFIPDVGRLPLKRSFGRLKMEALTDRELGLIDPDSGDESAQRG-QPA 622
gi 1709996 507 nvCDLLSISDCLSHDFPYSYTGDEISTWFSVQGTLFYLPS--PVPRKWRQLRFQQWNN--EGIVRGIFDDYMVIYG---- 578
gi 418428  528 kvENGIDVVDRIGGPIEALSVEDGLAPLMDNDSNNCDHLEDQKKERDRRLRMLIDQYERNVMMANDDLEDEETSFNdDPI 607
                      650       660       670
               ....*....|....*....|....*....|
gi 3410696 615 EESLGEPTQATV---PETWSLPLSQNSASE 641
gi 3758878 623 QEAPGEPAQAAQnadPETWSLPLSQNSGSD 652
gi 1709996 579 KRSVSDPVIEAH----EDQVLEDIDDPIED 604
gi 418428  608 VDSDSDNSNNIG---NETFGRSDEDESLCE 634
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap