1OYY,4O3M


Conserved Protein Domain Family
recQ_fam

?
TIGR00614: recQ_fam 
Click on image for an interactive view with Cn3D
ATP-dependent DNA helicase, RecQ family
All proteins in this family for which functions are known are 3'-5' DNA-DNA helicases. These proteins are used for recombination, recombinational repair, and possibly maintenance of chromosome stability. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129701
View PSSM: TIGR00614
Aligned: 10 rows
Threshold Bit Score: 767.01
Threshold Setting Gi: 531243
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OYY_A         15 QVLQETFGYQQFRPGQEEIIDTVLSGR-DCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAA 93
gi 2500112     18 SVLKSVFGYQSFRKGQEEVINAALNGQ-DALVVMATGNGKSLCYQIPALCFDGLTLVISPLISLMKDQVDQLQANGIEAD 96
gi 2130973    502 NCLKTYFGHSSFKPVQWKVIHSVLEERrDNVVVMATGYGKSLCFQYPPVYTGKIGIVISPLISLMEDQVLQLELSNVPAC 581
gi 322510082  538 TCLKMYFGHSSFKPVQWKVIHSVLEERrDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPAC 617
gi 3420291    479 SCLKTYFGHSSFKPVQWKVVHSVLRERrDNLVVMATGYGKSLCYQFAPVYTSGIGIVICPLISLMEDQVLQLEMSNISSC 558
gi 531243      81 DILQNVFKLEKFRPLQLETINVTMAGK-EVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISAT 159
gi 3452495    665 KIFHKKFGLHNFRTNQLEAINAALLGE-DCFILMPTGGGKSLCYQLPACVSPGVTIVISPLRSLIVDQVQKLTSFDIPAT 743
gi 447022602   17 QVLQETFGYQQFRPGQEEIIDTVLSGR-DCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAA 95
gi 1705486    657 KIFHKKFGLHNFRTNQLEAINAALLGE-DCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPAT 735
4O3M_A         18 KIFHKKFGLHNFRTNQLEAINAALLGE-DCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPAT 96
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OYY_A         94 CLNSTQTREQQLEVMTGC--RTGQIRLLYIAPERLMLDn-FLEHL----AHWNPVLLAVDEAHCISQWGHDFRPEYAALG 166
gi 2500112     97 FLNSSQTLEQQQQVQNKL--ISGQLKLLYVSPEKVMTNs-FFQLI----SYSKVCFIAIDEAHCISQWGHDFRPEYTQLG 169
gi 2130973    582 LLGSAQSKN----ILGDV--KLGKYRVIYITPEFCSGNldLLQKLd---SSIGITLIAVDEAHCISEWGHDFRSSFRMLG 652
gi 322510082  618 FLGSAQSEN----VLTDI--KLGKYRIVYVTPEYCSGNmgLLQQLe---ADIGITLIAVDEAHCISEWGHDFRDSFRKLG 688
gi 3420291    559 FLGSAQSKN----VLQDV--KDGKMRVIYMTPEFCSRGisLLQDLd---NRYGITLIAIDEAHCISEWGHDFRSAYRSLG 629
gi 531243     160 MLNASSSKEHVKWVHAEMvnKNSELKLIYVTPEKIAKSkmFMSRLekayEARRFTRIAVDEVHCCSQWGHDFRPDYKALG 239
gi 3452495    744 YLTGDKTDSEAANIYLQLskKDPIIKLLYVTPEKVCASnrLISTLenlyERKLLARFVIDEAHCVSQWGHDFRQDYKRMN 823
gi 447022602   96 CLNSTQTREQQLEVMTGC--RTGQIRLLYIAPERLMLDn-FLEHL----AHWNPVLLAVDEAHCISQWGHDFRPEYAALG 168
gi 1705486    736 YLTGDKTDSEATNIYLQLskKDPIIKLLYVTPEKICASnrLISTLenlyERKLLARFVIDEAHCVSQWGHDFRQDYKRMN 815
4O3M_A         97 YLTGDKTDSEATNIYLQLskKDPIIKLLYVTPEKICASnrLISTLenlyERKLLARFVIDEAHCVSQWGHDFRQDYKRMN 176
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OYY_A        167 QLRQRFPTLPFMALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKF----KPLDQLMRYVQ--------EQ 234
gi 2500112    170 GLKASFPDAPIMALTATADYATQQDILRHLNLKNLHKYIGSFDRPNIRYTLEEKY----KPMEQLTRFVL--------AQ 237
gi 2130973    653 SLKTALPLVPVIALSATASSSIREDIISCLNLKDPQITCTGFDRPNLYLEVGRKTg---NILQDLKPFLVrkas-sawEF 728
gi 322510082  689 SLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTg---NILQDLQPFLVkts--shwEF 763
gi 3420291    630 SLKRMLPNVPIVALTATASPSIREDITKSLNLHNPQVTCTSFDRPNLYLDVARKTt---NISIDLRQFLIkkqqgsgwEF 706
gi 531243     240 ILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPsnteDFIEDIVKLINg-------RY 312
gi 3452495    824 MLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKp--kKVAFDCLEWIRk-------HH 894
gi 447022602  169 QLRQRFPTLPFMALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKF----KPLDQLMRYVQ--------EQ 236
gi 1705486    816 MLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKp--kKVAFDCLEWIRk-------HH 886
4O3M_A        177 MLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKp--kKVAFDCLEWIRk-------HH 247
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OYY_A        235 RGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQ-RDDLQIVVATVAFGMGINKPNVRFVVHFDI 313
gi 2500112    238 KGKSGIIYCNSRNKVERIAESLRNKGVSAAAYHAGMETAIRERVQQDFQ-RDNVQVVVATIAFGMGINKSNVRFVAHFDL 316
gi 2130973    729 EGPT-IIYCPSRKMTEQVTAELGKLNLACRTYHAGMKISERKDVHHRFL-RDEIQCVVATVAFGMGINKADIRQVIHYGA 806
gi 322510082  764 EGPT-IIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFV-RDEIQCVIATIAFGMGINKADIRQVIHYGA 841
gi 3420291    707 EGAT-IVYCPTRKTSEQVTAELIKLGIACGTYHAGMGIKQRREVHHRFM-RDEIHCVVATVAFGMGINKPDIRKVIHYGA 784
gi 531243     313 KGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWS-ANEIQVVVATVAFGMGIDKPDVRFVIHHSM 391
gi 3452495    895 PYDSGIIYCLSRRECDTMADTLQREGLAALAYHAGLSDSARDEVQHKWInQDNCQVICATIAFGMGIDKPDVRFVIHASL 974
gi 447022602  237 RGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQ-RDDLQIVVATVAFGMGINKPNVRFVVHFDI 315
gi 1705486    887 PYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWInQDGCQVICATIAFGMGIDKPDVRFVIHASL 966
4O3M_A        248 PYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWInQDGCQVICATIAFGMGIDKPDVRFVIHASL 327
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OYY_A        314 PRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQ---LQDIERHKLNAMGAFAEAQTCRRLVLLNYFG 390
gi 2500112    317 PRSIESYYQETGRAGRDDLPAEAVLFYEPADYAWLQKILLEKPETP---QRQIEQHKLEAIGEFAESQTCRRLVLLNYFG 393
gi 2130973    807 PKEMESYYQEIGRAGRDGLQSSCHLLWAPADFNTSRNLLIEIHDEK---FRLYKLKMMVKMEKYLHSSQCRRRIILSHFE 883
gi 322510082  842 PKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEK---FRLYKLKMMAKMEKYLHSSRCRRQIILSHFE 918
gi 3420291    785 PKEMESYYQEIGRAGRDGLPSCCHALWAQADMNFNRHMLGEIPNKG---FREYKLKMLTKMEKYLNSSTCRRKIILSHFE 861
gi 531243     392 SKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVVMENVG----QQ----KLYEMVSYCQNISKCRRVLMAQHFD 463
gi 3452495    975 PKSMEGYYQESGRAGRDGEISHCVLFYTYHDVTRLKRLIMMEKDGNyhtKETHVNNLYSMVHYCENITECRRIQLLAYFG 1054
gi 447022602  316 PRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQ---LQDIERHKLNAMGAFAEAQTCRRLVLLNYFG 392
gi 1705486    967 PKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNhhtRETHFNNLYSMVHYCENITECRRIQLLAYFG 1046
4O3M_A        328 PKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNhhtRETHFNNLYSMVHYCENITECRRIQLLAYFG 407
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OYY_A        391 E-----------GRQEPCGNCDICLD--------PPKQYDGSTDAQIALSTIGRVN-------QRFGMGYVVEVIRGANN 444
gi 2500112    394 E-----------HRQTPCNNCDICLD--------PPKKYDGLVDAQKVMSTIYRVG-------QCFGAHYVIAVLRGMHN 447
gi 2130973    884 DkclqkasldimGTEKCCDNCRPRLNhcltannsEDASQDFGPQAFQLLSAVDILQ-------EKFGIGIPILFLRGSNS 956
gi 322510082  919 DkqvqkaslgimGTEKCCDNCRSRLDhcysmddsEDTSWDFGPQAFKLLSAVDILG-------EKFGIGLPILFLRGSNS 991
gi 3420291    862 DkqlrkassgimGTEKCCDNCKTRLIcnisindtEDNLQDFGPQAYKFISAVDVLG-------QKFGTGVPVLFLRGSTS 934
gi 531243     464 Evwn------seACNKMCDNCCKDSAfer--kniTEYCRDLIKILKQAEELNEKLt------pLKL-----IDSWMGKGA 524
gi 3452495   1055 Ekgfnp-dfckkYPDVSCDNCCKTKDykt--kdvTDDVKNIIRFVQEHSSSPGTRnig---paGRFTLNMLVDIFLGSKS 1128
gi 447022602  393 E-----------GRQEPCGNCDICLD--------PPKQYDGSTDAQIALSTIGRVN-------QRFGMGYVVEVIRGANN 446
gi 1705486   1047 Engfnp-dfckkHPDVSCDNCCKTKDykt--rdvTDDVKSIVRFVQEHSSSQGMRNikhvgpsGRFTMNMLVDIFLGSKS 1123
4O3M_A        408 Engfnp-dfckkHPDVSCDNCCKTKDykt--rdvTDDVKSIVRFVQEHSSSQGMRNikhvgpsGRFTMNMLVDIFLGSKS 484
                         490       500
                  ....*....|....*....|
1OYY_A        445 QRIRDYGHDKLKVYGMGRDK 464
gi 2500112    448 QKIIERQHHKLSVYGIGKDK 467
gi 2130973    957 QRLPDK-YRGHRLFGAGKEQ 975
gi 322510082  992 QRLADQ-YRRHSLFGTGKDQ 1010
gi 3420291    935 QRVPDR-FRNHSLFSSGKDQ 953
gi 531243     525 AKLRVAGVVAP-TLPREDLE 543
gi 3452495   1129 AKVKSGIFGKGTTYSRHNAE 1148
gi 447022602  447 QRIRDYGHDKLKVYGMGRDK 466
gi 1705486   1124 AKIQSGIFGKGSAYSRHNAE 1143
4O3M_A        485 AKIQSGIFGKGSAYSRHNAE 504
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap