Conserved Protein Domain Family
rect

?
TIGR00616: rect 
recombinase, phage RecT family
All proteins in this family for which functions are known bind ssDNA and are involved in the the pairing of homologous DNA This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). RecT and homologs are found in prophage regions of bacterial genomes. RecT works with a partner protein, RecE. [DNA metabolism, DNA replication, recombination, and repair, Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 129703
View PSSM: TIGR00616
Aligned: 3 rows
Threshold Bit Score: 355.057
Threshold Setting Gi: 1176730
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464602    1 MTKQPPIAKADLQKTQGNRAPAAVKNSD-VISFINQpsMKEQLAAALPRHMTAERMIRIATTEIRKVPALGNCDTMSFVS 79
gi 439634    2 ATKKQEELKNALAQQNGAVPQTPVKPQDkVKGYLER--MMPAIKDVLPKHLDADRLSRIAMNVIRTNPKLLECDTASLMG 79
gi 1176730   2 ATNQS--IKNNIQKKQKNVP-VQQQGAT-MKGLLSSpsVIKRFEEVLG--KRATQFTASILSLYNSEQMLQKTDPMSVIS 75
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464602   80 AIVQCSQLGLEPGsALGHAYLLPFGNKNEKSgkKNVQLIIGYRGMIDLARRSGQIASLSARVVREGDEFSFEFGLDEKLI 159
gi 439634   80 AVLESAKLGVEPG-LLGQAYILPYTNYKKKT--VEAQFILGYKGLLDLVRRSGHVSTISAQTVYKNDTFEYEYGLDDKLV 156
gi 1176730  76 SAMVAATLDLPIDkNLGYAWIVPYGG---KA-----QFQLGYKGYIQLALRTGQYKSINCIPIHEGELQKWNPLTEEIEI 147
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464602  160 HRP---GENEDAPVThVYAVARLKDGGTQFEVMTRKQIELVR-SLSKAGNN-----GPWVTHWEEMAKKTAIRRLF-KYL 229
gi 439634  157 HRPapfGTDRGEPVG-YYAVAKMKDGGYNFLVMSKQDVEKHRdAFSKSKNRegvvyGPWADHFDAMAKKTVLRQLI-NYL 234
gi 1176730 148 DFE---KRESDAVIG-YAAYFELINGFRKTVYWTKAQVEKHKkKFSKSDFG-------WKNDWDAMALKTVLKAVLsKWG 216
                      250
               ....*....|....
gi 464602  230 PVSIEIQRAVSMDE 243
gi 439634  235 PISVEQLSGVAADE 248
gi 1176730 217 ILSVEMQKAVIEED 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap