Conserved Protein Domain Family
sbcc

?
TIGR00618: sbcc 
exonuclease SbcC
All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129705
View PSSM: TIGR00618
Aligned: 5 rows
Threshold Bit Score: 817.285
Threshold Setting Gi: 18202107
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204     1 MKPMRLTLHNIGPFVGTHTVDFTALG----PIFLVCGKTGSGKTTLFDAIAYALYGKpLGTRAEVIRSLRSHYAAPSEAA 76
gi 3322922      1 MKPMRLTLHNIGPFVGTHTVDFTALG----PIFLVCGKTGSGKTTLFDAIAYALYGKpLGTRAEVIRSLRSHYAAPSEAA 76
gi 134253       1 MKILSLRLKNLNSLKGEWKIDFTREPfasnGLFAITGPTGAGKTTLLDAICLALYHE-TPRLSNVSQSQNDLMTRDTAEC 79
gi 18202107     1 MRPLKLEVKGFTVYKKPQVIDFTPl-----KFFVIQGKTGAGKTSIIDAITYALYGK-VPRYGASVATKYVLSRG----- 69
gi 499174073    1 MVPQQLILKNFLSYQDVSLNFRGl------HTACICGSNGAGKSSLLEAITWAIWGK-CRAESEDDVLHNGTDQVR---- 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204    77 FATLEFSLGTKIYRVHRTLTCTLSHRKTEQPEQLYLEQKKGHGweRIACAHKSETECVIHDLLKLNSKEFERVVMLPQGE 156
gi 3322922     77 FATLEFSLGTKIYRVHRTLTCTLSHRKTEQPEQLYLEQKKGHGweRIACAHKSETECVIHDLLKLNSKEFERVVMLPQGE 156
gi 134253      80 LAEVEFEVKGEAYRAFWSQNRARNQPDGNLQVPRVELARCADG--KILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQ 157
gi 18202107    70 EKELKVALDFSLRG--RNYRVERYYREFPEDSQVRVYEEGRR-----LNIKANEVEKWLFKISGLDYKTFTKVILLPQGE 142
gi 499174073   70 -VDFEFISNNQTYR---IIRSRQRGRSSVTEFQIKSG-DHFR---TLSAKGLRATQEKITNTLKLDYETFVNSAYLRQGR 141
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   157 CAQFLKANSKEKKETL--MNLFPVDQYT--ALMERAKKKSLHAKAVLETLRSQLETLCAECMPDTYHERKQTLEAELQHA 232
gi 3322922    157 CAQFLKANSKEKKETL--MNLFPVDQYT--ALMERAKKKSLHAKAVLETLRSQLETLCAECMPDTYHERKQTLEAELQHA 232
gi 134253     158 FAAFLNAKPKERAELL--EELTGTEIYGqiSAMVFEQHKSARTELEKLQAQASGVTLLTPEQVQSLTASLQVLTDEEKQL 235
gi 18202107   143 FDRFLKESSERKKILInlLGLEELEKVRqlASETFKN---LEGKREALKKEYELLKDYTP-------TKKEVLEKTLKNL 212
gi 499174073  142 ADEFMLRKPSERKQIL--ADLLKLDQYEmlATRAKDISkEAKGKINILDERLQILEQDLNQR----PDVVANQAKLVAEI 215
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   233 RDALQQTRISHAYYTQKREALEAQLKKQQLCKELRARIETYRAQEPVHAETQKRIDRARKAAPLAAHIKHVTQCEQDAQR 312
gi 3322922    233 RDALQQTRISHAYYTQKREALEAQLKKQQLCKELRARIETYRAQEPVHAETQKRIDRARKAAPLAAHIKHVTQCEQDAQR 312
gi 134253     236 ITAQQQEQQSLNWLTRQDELQQEASRRQQALQQALAEEEKAQPQLAALSLAQPARNLRPHWERIAEHSAALAHIRQQIEE 315
gi 18202107   213 EEELKELKETEEKLRQELKKAEEKDSLERELSQVVTKLKELENLEKEVEKLREKLEFSRKVAPYVPIAKRIEEIDKK--- 289
gi 499174073  216 TEVQAQQQQTQWQLQQLQTSQNQRQQWQKQAGWQQRQCQELTTEIARLENQNEEINQQCQKLKLLLEQEAVIQVNFQr-- 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   313 IHAEIQEKMRSREQLLMKRAAHVAQQSSIEEQRRLLQTLHSACIHIEDAHDVATSIRDISCQAHTLTQHIHTLAQQKTTL 392
gi 3322922    313 IHAEIQEKMRSREQLLMKRAAHVAQQSSIEEQRRLLQTLHSACIHIEDAHDVATSIRDISCQAHTLTQHIHTLAQQKTTL 392
gi 134253     316 VNTRLQSTMALRASIRHH---AAKQSAELQQQQQSLNTWLQEHDRFRQWNNEPAGWRAQFSQQTSDREHLRQWQQQLTHA 392
gi 18202107   290 -LTELKVRKNKLTKELA----VLKDELS-----------FAQEELNRIEAEKEK-FKEEKEREKELEHRLKKLQEIKEIL 352
gi 499174073  294 -YQTLQSQETELAKAFQQYQNLQQQRQD------LEQQLQRQENELARQTEQQLLRLEHLDKQLAELQPILAQQQDIEAD 366
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   393 TQQEQSLCKELDILQR-EAGTIDTRTSAFNDLQIQLAHAKKTQELSQRYAELCAAHATCTAQCEKLEKIHAQKSAYSTRA 471
gi 3322922    393 TQQEQSLCKELDILQR-EAGTIDTRTSAFNDLQIQLAHAKKTQELSQRYAELCAAHATCTAQCEKLEKIHAQKSAYSTRA 471
gi 134253     393 EQKLNALAAITLTLTAdEVATALAQHAEQRPLRQHLVALHGQIVPQQKRLAQLQVAIQNVTQEQTQRNAALNEMRQRYKE 472
gi 18202107   353 KELSQLSSSLKEKEREyEQAKQEFEDLSERVEKGKKLVAETEEKLEK----IKELFSEEEYTSLKMKERLLVELQRKLKE 428
gi 499174073  367 LDKLKIAKQKLSQLDN-LQHQVAPLLQRRSALQGDLARARAQCQAQLe----QRQAIAKQLQIAIAAIPEQRRAFQALDE 441
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   472 REQLLQTKEQIHLQETRTHAVVLARLLEHQ-EPCPVCGSCIHPNPARQDIDNLEPLTRRMQRIEQTYAQLETSEKDVYHI 550
gi 3322922    472 REQLLQTKEQIHLQETRTHAVVLARLLEHQ-EPCPVCGSCIHPNPARQDIDNLEPLTRRMQRIEQTYAQLETSEKDVYHI 550
gi 134253     473 KTQQLADVKTICEQEARIKTLEAQRAQLQAgQPCPLCGSTSHPAVEAYQALEPGVNQSRLLALENEVKKLGEEGATLRGQ 552
gi 18202107   429 LKEKEGQLENLTQKYKEKKKVHEKVLNELKeLERELKERELHYHAHMVASYLSPGDTCPVCGGIYR---G-KALENVDAE 504
gi 499174073  442 EIFQLKNKQVYLKRVEEKGQERGHFKERLQeNQRLFEKQLRELEQKLTLLGIPGATCPLCEQGLDGh-YHQQVIEKTEHQ 520
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   551 LTSERERRASYSAQMQEIQHSFSIL-TSCDTRSSCDIPNVQKITVRVLDLTEKLSRAKDMLACAQHALLRKKQPEQDLQD 629
gi 3322922    551 LTSERERRASYSAQMQEIQHSFSIL-TSCDTRSSCDIPNVQKITVRVLDLTEKLSRAKDMLACAQHALLRKKQPEQDLQD 629
gi 134253     553 LDAITKQLQRDENEAQSLRQDEQAL-TQQWQAVTASLNITLQPLDDIQPWLDAQDEHERQLRLLSQRHELQGQIAAHNQQ 631
gi 18202107   505 GISELKHAKELKEKEEREIDTTLKLyAQKINSLKEEMEKLRNEVEELRKEIPENLKERIKKLEELRIEKEKLEHKLNKYR 584
gi 499174073  521 CQELRNQIWILKEQITLADQEL----AILRNEYKEIADGLTNLEQLLQHYGQMEAELEKS--GENHEQLVELNEQIADLE 594
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   630 VRAHLQQCSQELAKKETALHALQETLTQQRVRIHALSIR-LPKELLASNLLAPQKMQHEKESVAYWKEMLAHCQTLMREL 708
gi 3322922    630 VRAHLQQCSQELAKKETALHALQETLTQQRVRIHALSIR-LPKELLASNLLAPQKMQHEKESVAYWKEMLAHCQTLMREL 708
gi 134253     632 IIQYQQQIEQRQQLLLTTLTGYALTLPQEDEEESWLATRqQEAQSWQQRQNELTALQNRIQQLTPILETLPQSDELPHCE 711
gi 18202107   585 KALEDRQKQKEEAQAKLHKAQTELELLKEKIREKSRLVKeFKELY--RVERLEDYEESL-------KEEINYINSKLQEI 655
gi 499174073  595 LSLTEGNFAESLQLELAALERELTNLAYDEQTHALARSTvDQLRKGEIRQAKLKEAQSKYRQLTGDRPGLEQKLLALRSQ 674
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   709 HTHIEEYDREFNEIENASSALGADIAAREDALNHVQKEYMHLARTVCCARTEAHFN-NNEEVTAALMTDAELSHAAAEIQ 787
gi 3322922    709 HTHIEEYDREFNEIENASSALGADIAAREDALNHVQKEYMHLARTVCCARTEAHFN-NNEEVTAALMTDAELSHAAAEIQ 787
gi 134253     712 ETVVLENWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQFDTALQASVFDDQQ-AFLAALMDEQTLTQLEQLKQNLE 790
gi 18202107   656 EEKEKKLRKHFEELS----SRKSKLEGELSALNESINSLEEERKEKLKELANIYEVaKSPREVVELYLGDKEAELER--- 728
gi 499174073  675 LQSLGTSSPLRQQWQQVS-TAISELNYNNETHQQLLGELRRQQPWQLKHQELEQAR---QQLPILIQRGQEYQDLIGD-- 748
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   788 FFNELRAADTHLLKTLEAEIGTEIPSDLDELNAQCHTLVKDEENFLSRIEILS---ATLHTLTHQYLKYEECSKQLAQKT 864
gi 3322922    788 FFNELRAADTHLLKTLEAEIGTEIPSDLDELNAQCHTLVKDEENFLSRIEILS---ATLHTLTHQYLKYEECSKQLAQKT 864
gi 134253     791 NQRRQAQTLVTQTAETLAQHQQHRPDDGLALTVTVEQIQQELAQTHQKLRENT---TSQGEIRQQLKQDADNRQQQQTLM 867
gi 18202107   729 -KIKEFEESFQSLKLKKSEIEEKLKEYEGIRELSDIK--GEYESVKTQLEEKH---KKLGEVKRELEHLGERLKRKEEL- 801
gi 499174073  749 -RQRALEERQGELAQLEEQIRQYADHGEQIKLLEQEL-AQRRQQLDNLLAKKGgleQLLIQIDTLQGEYEETKQQFDQA- 825
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   865 QESAKLITLSDELNGINQKKIQFDAWALISFLHEITAYANIRLQKMSEGRYHLRVADSHVNARGYQGLALLVADAYT-GS 943
gi 3322922    865 QESAKLITLSDELNGINQKKIQFDAWALISFLHEITAYANIRLQKMSEGRYHLRVADSHVNARGYQGLALLVADAYT-GS 943
gi 134253     868 QQIAQMTQQVEDWGYLNSLIGSKEGDKFRKFAQGLTLDNLVHLANQQLTRLHGRYLLQRKAS--EALEVEVVDTWQA-DA 944
gi 18202107   802 --QKEISELEKKLEVYRVISNDFRGDRFQKYVSEIMLQKVVDRASEYFYKFTGNYFFELERATKGRDKDIVVVESST-SQ 878
gi 499174073  826 KKQFRIHQELGKAFGKDGIQVMIIENILPQLEAETNYILARLTGNQHHIQFVTQKEGKSSTKNKPKMINTLDILIADaQG 905
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17433204   944 VRPSATLSGGETFMASISLALGLADSIQTrSGGIVLDSLFIDEGFGSLDEASLDKAIGILDEIRE-GSRMIGIISHVHEL 1022
gi 3322922    944 VRPSATLSGGETFMASISLALGLADSIQTrSGGIVLDSLFIDEGFGSLDEASLDKAIGILDEIRE-GSRMIGIISHVHEL 1022
gi 134253     945 VRDTRTLSGGESFLVSLALALALSDLVS---HKTRIDSLFLDEGFGTLDSETLDTALDALDALNA-SGKTIGVISHVEAM 1020
gi 18202107   879 RRPVSSLSGGETFLASLSFAFAVSDLLS---GSANLESLFIDEGFGSLDQDMRERVSEILEAIKTnVNKMIGIVSHIPDF 955
gi 499174073  906 TRPYETYSGGEAFRINFSIRLALAKLLAQ-RSGTALQLLIIDEGFGTQDADGCDRLVAAITAIASdFACILTVT-HMPQF 983
                        1050      1060
                  ....*....|....*....|
gi 17433204  1023 RTRIPHKILIKKTNAGSHVM 1042
gi 3322922   1023 RTRIPHKILIKKTNAGSHVM 1042
gi 134253    1021 KERIPVQIKVKKINGLGYSK 1040
gi 18202107   956 AERFTERIVVEKKGDYSEVR 975
gi 499174073  984 REAFQQRIEVNKTEFGSQLA 1003
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap