Conserved Protein Domain Family
ssl1

?
TIGR00622: ssl1 
transcription factor ssl1
All proteins in this family for which functions are known are components of the TFIIH complex which is involved in the initiaiton of transcription and nucleotide excision repair.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129709
View PSSM: TIGR00622
Aligned: 3 rows
Threshold Bit Score: 183.213
Threshold Setting Gi: 17380326
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 417813   346 GYFCPNCHSKVCSLPTVCPCCDLMLILSTHLARSYHHLMPLKTFAEVPTTEKFRSEDCFSCQSRFPILKNHKNGKLLTSS 425
gi 3406059  308 GFHCPRCKAKVCTLPIECPSCSLVLILSTHLARSYHHLFPLKNWSEIPWSANPKSTHCFACQLPFPKPPVSPFDESTSSM 387
gi 17380326 288 GYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQG-----------ELKDQH 356
                        90       100       110
                ....*....|....*....|....*....|..
gi 417813   426 RYRCEDCKQEFCVDCDVFIHEILHNCPGCESK 457
gi 3406059  388 RYACPSCKNHFCLDCDVFAHEQLHECYGCQCS 419
gi 17380326 357 VYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap