Conserved Protein Domain Family
sula

?
TIGR00623: sula 
cell division inhibitor SulA
All proteins in this family for which the functions are known are cell division inhibitors. In E. coli, SulA is one of the SOS regulated genes. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129710
View PSSM: TIGR00623
Aligned: 4 rows
Threshold Bit Score: 281.83
Threshold Setting Gi: 135049
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135046   2 YTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQAS 81
gi 154378   2 YTSGYANRSSSFPTTTHNAARTATENAAAGLVSEVVYHEDQPMMAQLLLLPLLRQLGQQSRWQLWLTPQQKLSREWVQSS 81
gi 135047   2 FTSAHANRSPLTSASVRRPSHSVVEHSATGLISEIVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSKEWVQSS 81
gi 135049   3 TQSLYQPHFGHGSYTTRNVAKNTDIGKENGLISELVYNERQPAVAQ-LLLPLLLQLGKQSRWLLWLTPQQKLSKQWLQQS 81
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 135046  82 GLPLTKVMQISQLSPCHTVESMVRALRTGNYSVVIGWLADDLTEEEHAELVDAANEGNAMGFIMRPVSASSHATRQLSGL 161
gi 154378  82 GLPLTKVMQISQLAPRHTLETMIRALATGNYSVVIGWMTEELTEEEHASLVEAAKVGNAVGFIMRPVRALALPRRQHSGL 161
gi 135047  82 GLPLSKVMQINQMSPCNTLESMIRALRTGNYNVVIGWLTDELTEQEHERLALAAEEGHPMGFIMRPVRNTSQPGRQLSGL 161
gi 135049  82 GLPVDKMVQLSQISPVNTVEAMEKALQTGNYSVVLGWLP-ELTEEDRLKLRRAAELGNAYGFIMRPQRDISPTHGHCSTL 160

              ....*...
gi 135046 162 KIHSNLYH 169
gi 154378 162 KIHSNLYH 169
gi 135047 162 KIHSNLYH 169
gi 135049 161 KIHSSLYH 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap