Conserved Protein Domain Family
recU

?
TIGR00648: recU 
recombination protein U
The Bacillus protein has been shown to be required for DNA recombination and repair. RJD 11/20/00 [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129734
View PSSM: TIGR00648
Aligned: 3 rows
Threshold Bit Score: 244.092
Threshold Setting Gi: 2496401
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7674177  31 GRGMSLEKDIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEAKETKNKT 110
gi 732244   30 NRGMTLEDDLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQSSTTDYNGIYKGRYIDFEAKETKNKT 109
gi 2496401   5 NRGMLLETIVNQTIARLKDHPDIWLEKRFLPIKPIAFRHAHVSGNVS------QKSKTDYYGIYKGMYFDFEAKQT-NKS 77
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7674177 111 SFPLNNIHDHQVEHMKNAYQQKGIVFLMIRfkTLDEVYLLPYSKFEVFWKRYKDNIKKSITVDEIRKNGYHIPYQYQPRL 190
gi 732244  110 SFPLQNFHDHQIEHMKQVKAQDGICFVIIS--AFDQVYFLEADKLFYFWDRKEKNGRKSIRKDELEETAYPISLGYAPRI 187
gi 2496401  78 NFPIAQIAEHQLNHLKRIDQIGGVSFLLIYfqTKDQIFAFHTKDLLETIKNQES---KTIKRELIEQKSQKVPLLYPGII 154

               ....*....
gi 7674177 191 DYLKAVDKL 199
gi 732244  188 DYISIIEQL 196
gi 2496401 155 DLISIIQSF 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap