Conserved Protein Domain Family
kdpC

?
TIGR00681: kdpC 
K+-transporting ATPase, C subunit
This chain has a single predicted transmembrane region near the amino end. It is part of a K+-transport ATPase that contains two other membrane-bound subunits, KdpA and KdpB, and a small subunit KdpF. KdpA is the K+-translocating subunit, KdpB the ATP-hydrolyzing subunit. During assembly of the complex, KdpA and KdpC bind to each other. This interaction is thought to stabilize the complex [MEDLINE:9858692]. Data indicates that KdpC might connect the KdpA, the K+-transporting subunit, to KdpB, the ATP-hydrolyzing (energy providing) subunit [MEDLINE:9858692]. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129764
View PSSM: TIGR00681
Aligned: 3 rows
Threshold Bit Score: 289.121
Threshold Setting Gi: 3121786
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114368    2 SGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREG-DTVRGSALIGQNFTGNGYFHGRPSATAEMp---- 76
gi 3121789   3 RQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERD-GQVIGSAHIGQQFTAAKYFHPRPSSAGDG----- 76
gi 3121786   3 RNFVISLRSTALLWILTALIYPAIVLVIGQLVFPYQANGSLITDSqGQVVGSALIGQTFTEEGYFWSRPSAINYSegada 82
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114368   77 YNPQASGGSNLAVSNPELDKLIAARVAALRAAN-PDASASVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQL 155
gi 3121789  77 YDAAASSGSNLGPTNEKLLAAVAERVTAYRKENnLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQV 156
gi 3121786  83 SPTGISGASNLAPSNPDLLSRIEA--EAQRLED---NAVQPTADLLYSSGSGLDPHISPAAAQAQFDRVAKARSIPPQEL 157
                      170       180       190
               ....*....|....*....|....*....|...
gi 114368  156 TQLIAKYSQQPLVKYIGQPVVNIVELNLALDKL 188
gi 3121789 157 ERLIEDHTDARGLGFLGERAVNVLRLNLALDRL 189
gi 3121786 158 QSLITKHTEGRFLGIFGEPGVNVLTLNLALDNR 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap