4EAC


Conserved Protein Domain Family
uxuA

?
TIGR00695: uxuA 
Click on image for an interactive view with Cn3D
mannonate dehydratase
This Fe2+-requiring enzyme plays a role in D-glucuronate catabolism in Escherichia coli. Mannonate dehydratase converts D-mannonate to 2-dehydro-3-deoxy-D-gluconate. An apparent equivalog is found in a glucuronate utilization operon in Bacillus stearothermophilus T-6. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 129778
View PSSM: TIGR00695
Aligned: 4 rows
Threshold Bit Score: 619.299
Threshold Setting Gi: 7531224
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4EAC_A      21 MEQTWRWYGP-NDPVSLADVRQA-GATGVVTALHHIPNGEVWSVEEILKRKAIIEDAGLVWSVVESVPIHEDIKTHTGNY 98
gi 1174927   1 MEQAWRWYGP-KDPVSLSDIRQA-GATGIVTALHHIPNGEIWGIEEIKKRKTEIENAGLSWSVVESVPVHEEIKTQTGNY 78
gi 7531224   1 MNMTFRWYGRgNDTVTLEYVKQIpGVKGIVWALHQKPVGDVWEKEEIRAETEYIQSYGFHAEVVESVNVHEAIKLGNEER 80
gi 731088    1 MEQTWRWYGP-NDPVSLADVRQA-GATGVVTALHHIPNGEVWSVEEILKRKAIIEDAGLVWSVVESVPIHEDIKTHTGNY 78
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4EAC_A      99 EQWIANYQQTLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLPDGSKALRFDQIEFAAFEMHILKRPGAEADYTEEEIAQA 178
gi 1174927  79 QKWINNYKQTLRNLAQCGIDTVCYNFMPVLDWTRTDLAYELPDGSKALRFDHIAFAAFELHILKRPDAEKTYNQEEQVAA 158
gi 7531224  81 GRYIENYKQTIRNLAGFGVKVICYNFMPVFDWTRTDMFRPLEDGSTALFFEKAKVESLD------P--------QELIRT 146
gi 731088   79 EQWIANYQQTLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLPDGSKALRFDQIEFAAFEMHILKRPGAEADYTEEEIAQA 158
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4EAC_A     179 AERFATMSDEDKARLTRNIIAGLPGAEEGYTLDQFRKHLELYKDIDKAKLRENFAVFLKAIIPVAEEVGVRMAVHPDDPP 258
gi 1174927 159 RTYYDNMSEQDIAQLTRNIIAGLPGAEEGYTLDEFQTQLDRYKDISSEKFRTHLAYFLNEIVPVAQEIGIKMAIHPDDPP 238
gi 7531224 147 VEEASDMT--------------LPGWEP-EKLARIKELFAAYRTVDEEKLWDNLSFFLQEILPVAEAYGVQMAIHPDDPP 211
gi 731088  159 AERFATMSDEDKARLTRNIIAGLPGAEEGYTLDQFRKHLELYKDIDKAKLRENFAVFLKAIIPVAEEVGVRMAVHPDDPP 238
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4EAC_A     259 RPILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLRSTMREDNPKTFHEAAHLN 338
gi 1174927 239 RPILGLPRIVSTIEDMQWFVETQPLPANGFTMCTGSYGVRSDNDLVKMTEQFADRIYFAHLRSTQREGNPLTFHEAAHLE 318
gi 7531224 212 WPIFGLPRIITGEASYKKLRAISDSPSNCITLCTGSMGANPANDMVEIAKTYAGIAPFSHIRNVKIYENG-DFIETSHLT 290
gi 731088  239 RPILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLRSTMREDNPKTFHEAAHLN 318
                      330       340       350       360       370       380       390
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
4EAC_A     339 GDVDMYEVVKAIVEEEHRRKAEGKEDLIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEVRGVELAIQRAFFSR 414
gi 1174927 319 GDVDMFNVVKALLNEEYRRLNQGETRLIPMRPDHGHQILDDLRKKTNPGYSAIGRLKGLAEFRGLEMALKKVYFNK 394
gi 7531224 291 KDGSIN--IQGVMEELHKQDYEG----Y-VRPDHGRHLWG---EQCRPGYGLYDRALGIMYLNGLWDAYEAMAKKE 356
gi 731088  319 GDVDMYEVVKAIVEEEHRRKAEGKEDLIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEVRGVELAIQRAFFSR 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap