Conserved Protein Domain Family
wecG_tagA_cpsF

?
TIGR00696: wecG_tagA_cpsF 
bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family
The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129779
View PSSM: TIGR00696
Aligned: 4 rows
Threshold Bit Score: 281.679
Threshold Setting Gi: 2851574
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2851574    60 ELINAAEFKYADGISVVRSVRKKYPqAQVSRVAGADLWEELMARAGKEGT--PVFLVGGKPEVLAQTEAKLRNQWNVNIV 137
gi 135271     55 DVLSSSNFILPDGIGVVMMSRLTNN-RLQSRIAGYDVFKELLGVANKKKK--RIFLYGAKKDVIKGVVSKISSEYPNIKI 131
gi 499175307  61 EVIQGAELVIPDGAGVTIYLKLEG--IEQSRCPGIELAEAMVRHIGEGKDnqPIAFYGGAPGITELAAQRWQREYPGLKI 138
gi 407957093  59 EIINQAVLVTPDGMPLVWGLKLLGY-PQATRVYGPDLMLTICQRAAAENL--GIYLYGGTEDCLQQLKVNLIKRFPKLKI 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2851574   138 GSQ----DGYFKPEqRQALFERIHASGAQIVTVAMGSPKQEIIMRDCRLVHPDALYMGVGGTYDVFTGHVKRAPKIWQTL 213
gi 135271    132 AGY----SDGYVQD-RTLVAKQIARANPDMVFVALGYPHQEKFIHNYRHLFPKAVSIGLGGSFDVFSGNVKRAPSWMIRL 206
gi 499175307 139 LAN----HGFLTESeQDAWQQTLARERPCLILVGLGVPRQEYWIRDHRHLCPQGIWIGVGGSFDVWSGTKQRAPEFFCRY 214
gi 407957093 136 VGAdsppFRPLEPEeEKNALAKIKQSGAGILFVGLGCPKQEIWMANH-YQKIDLVMVGVGAAFNFHSGLVSQAPRWLMAM 214
                        170       180
                 ....*....|....*....|....
gi 2851574   214 GLEWLYRLLSQPSRIKRQLRLLRY 237
gi 135271    207 NLEWFYRLILNPWRWKRMLSIPKY 230
gi 499175307 215 NLEWFYRLYQEPWRWRRMLALPKF 238
gi 407957093 215 GLEWLYRLRMEPKRLWRRYLINNP 238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap